Gene Card
Gene overview
cDNA / CDS / Protein Sequences
363 bp · LXL04_021058|LXL04_021058|OH1004|cDNA
ATGGCTTCTAACACCATGGTGGATGTAAGACAGGGATTGGCTGTGGATACTCTAAAGTCAATGATAGAGAATGGGGAAGGTTGCAGCTATGATTTTGCTTTTGTTGATGCTGAGAAAAGAATGTACCCTGAATACTTTGAGTTACTGCTAAAATTGGTGAGAGTAGGTGGTGTTATAGTAATTGATAATGTGCTTTGGCATGGAAAAGTTGCTGATCCTATGGTTAATGATAAGAAAACTGAGAGCATAAGAAGTTTCAA...
363 bp · LXL04_021058|LXL04_021058|OH1004|CDS
ATGGCTTCTAACACCATGGTGGATGTAAGACAGGGATTGGCTGTGGATACTCTAAAGTCAATGATAGAGAATGGGGAAGGTTGCAGCTATGATTTTGCTTTTGTTGATGCTGAGAAAAGAATGTACCCTGAATACTTTGAGTTACTGCTAAAATTGGTGAGAGTAGGTGGTGTTATAGTAATTGATAATGTGCTTTGGCATGGAAAAGTTGCTGATCCTATGGTTAATGATAAGAAAACTGAGAGCATAAGAAGTTTCAA...
Protein
Download Protein FASTA120 aa · LXL04_021058|LXL04_021058|OH1004|PROTEIN
MASNTMVDVRQGLAVDTLKSMIENGEGCSYDFAFVDAEKRMYPEYFELLLKLVRVGGVIVIDNVLWHGKVADPMVNDKKTESIRSFNRALIEDKRVTISMVPWSNIGQEPVLVYWNALET
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_021058 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_021058 |
|---|---|
| Location | Chr04:120210825-120211878 (-) |
| Description | Similar to omt5: Probable caffeoyl-CoA O-methyltransferase 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0009617 response to bacterium Biological Process GO:0017000 antibiotic biosynthetic process Biological Process GO:0032259 methylation Biological Process GO:0005739 mitochondrion Cellular Component GO:0016020 membrane Cellular Component GO:0045335 phagocytic vesicle Cellular Component GO:0008171 O-methyltransferase activity Molecular Function GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Molecular Function GO:0042409 caffeoyl-CoA O-methyltransferase activity Molecular Function GO:0046872 metal ion binding Molecular Function |
| KEGG gene cross-reference | ddi:DDB_G0275499 ddi:DDB_G0275501 hsa:118881 mmu:69156 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01596.24Methyltransf_36-102 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_021058 | PF01596.24 | Methyltransf_3 | 6 | 102 | 2.4e-29 | 102.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.