TkA02G513990 | RubberDandelionOmics

Gene overview

TkA02G513990

Reference: TK1151 Chr: Chr02 Coordinates: 132330952-132334506 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2492 bp · TkA02G513990|TK1151|cDNA

AAATTTATTAGAGCATTTTCAATAATAGGTTATTAGAAAACTTTTACCTATTGAACAAGTCATATAATAACTTATGACCTTCTAGTAAAAAAAAAATCAACCAAAATCTTATTCTCAAGTCTTTTGCAAAATATAAAAAAGTTTTAAATTTTTTGCAAGAGATAAAAAAAGCTTTTCATAAATTTAGATGTATTAAATAAAAGCTTTTTTAAAAGATTATCCATCTAACTTGGACGCATGGAGCGATGCGAGGGTGCCAA...

CDS

Download CDS FASTA

1749 bp · TkA02G513990|TK1151|CDS

ATGGGCACTTTTCATGGCACACACGAAATCACTGAACTAGAAGAAGCCTCAAGTTTCAAATCCAGTAAGCATGGAGAGAAGTTCTACATAGAAGATGAAATCAACCGCCTTTTTGAAACAATTAGGGTTTCCGCCAAAACAACAGGTTTACAACAAGCTCTTAGAGATAAACAGAAGAAATCCATGAAACAACCAATGAAAGTTGGCTCTTATCAAGTATCAAAAATCGGGATTTCAGAACCTGTTAGTTTAAAGCAGGC...

Protein

Download Protein FASTA

582 aa · TkA02G513990|TK1151|PROTEIN

MGTFHGTHEITELEEASSFKSSKHGEKFYIEDEINRLFETIRVSAKTTGLQQALRDKQKKSMKQPMKVGSYQVSKIGISEPVSLKQALRGLSISQASEMAAMKRSPKPITSSGHQDMAEVTLVPETSTSTSNPPKKIPKSLQTRNLKLKLSSLSTPRKKLEKVKPDPVKEVKQRPKIMVNKTDDKKGEFSQSSKSSSLGECSSSTSFSCDSNISNVSSRPHMSKDSRWEAVLCAQKHHGSLNFKNFKLIKKIGGGDLGSV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G513990`
TK1151 ID	TkA02G513990
OH-1004 ID	LXL04_032545
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	45.300
Protein coverage (%)	TK1151 97.251 / OH-1004 76.045 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G513990

Location Chr02:132330952-132334506 (+)

Description Similar to KIPK1: Serine/threonine-protein kinase KIPK1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36350`	Serine/threonine-protein kinase that could be involved in the negative regulation of root growth.	No verified direct reference in this release
`At3g52890`	Could be involved in the negative regulation of root growth.	PERK-KIPK-KCBP signalling negatively regulates root growth in Arabidopsis thaliana.2015 · DOI: 10.1093/jxb/eru390
`At4g26610`	Protein kinase that regulates the auxin transport activity of PIN auxin efflux facilitators by direct phosphorylation.	D6PK AGCVIII kinases are required for auxin transport and phototropic hypocotyl bending in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111484

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0291600`	May play a role in the regulation of metabolism and signal transduction processes.	No verified direct reference in this release
`UniProt: A2YBX5`	May play a role in the regulation of metabolism and signal transduction processes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032545 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0009638 phototropism Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0010540 basipetal auxin transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016301 kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G36350

ath:AT3G52890

ath:AT5G47750

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.589

Rank 1 · TkA02G513990 · TK1151

Nucleus0.358

Rank 2 · TkA02G513990 · TK1151

Cell membrane0.138

Rank 3 · TkA02G513990 · TK1151

Mitochondrion0.055

Rank 4 · TkA02G513990 · TK1151

Golgi apparatus0.044

Rank 5 · TkA02G513990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14531Kinase-like128-185 aa

PF00069Pkinase246-400 aa

PF07714PK_Tyr_Ser-Thr247-396 aa

PF03109ABC1291-396 aa

PF06293Kdo320-392 aa

PF14531Kinase-like337-391 aa

PF00069Pkinase443-547 aa

PF07714PK_Tyr_Ser-Thr451-531 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G513990	`PF14531`	Kinase-like	128	185	0.018	15.0
TkA02G513990	`PF00069`	Pkinase	246	400	1.8e-58	198.7
TkA02G513990	`PF07714`	PK_Tyr_Ser-Thr	247	396	7.7e-28	98.2
TkA02G513990	`PF03109`	ABC1	291	396	7.9e-06	25.9
TkA02G513990	`PF06293`	Kdo	320	392	0.0026	17.9
TkA02G513990	`PF14531`	Kinase-like	337	391	0.018	15.0
TkA02G513990	`PF00069`	Pkinase	443	547	1.8e-58	198.7
TkA02G513990	`PF07714`	PK_Tyr_Ser-Thr	451	531	7.7e-28	98.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJM3`	Arabidopsis thaliana	sp\|Q9SJM3\|KIPK2_ARATH Serine/threonine-protein kinase KIPK2	58.800%	Swiss-Prot	Medium
`Q9LFA2`	Arabidopsis thaliana	sp\|Q9LFA2\|KIPK1_ARATH Serine/threonine-protein kinase KIPK1	60.000%	Swiss-Prot	Medium
`Q9SUA3`	Arabidopsis thaliana	sp\|Q9SUA3\|D6KL1_ARATH Serine/threonine-protein kinase D6PKL1	56.300%	Swiss-Prot	Medium
`Q0DCT8`	Oryza sativa subsp. japonica	sp\|Q0DCT8\|G11A_ORYSJ Protein kinase G11A	57.100%	Swiss-Prot	Medium
`A2YBX5`	Oryza sativa subsp. indica	sp\|A2YBX5\|G11A_ORYSI Protein kinase G11A	57.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card