TkA02G513510 | RubberDandelionOmics

Gene overview

TkA02G513510

Reference: TK1151 Chr: Chr02 Coordinates: 131848620-131851450 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

798 bp · TkA02G513510|TK1151|cDNA

ACACAGGGGAATTTTACTGGAATTCAGGCGGAAAACCCTATCGCTGTGACTGTGACCAAGGAAGCCGGCGGCTCAACCGTTGCTCCTGCTCACGTCAGTCGTCGGCGCAAGCCCTTGATGAAGAAGGGTAAGGGTGTGCATAAGAAGAAACGGATTTCCGATAGTGATGATGCGTTTGTTCCTCCTCCTCTCCCTCCAAATATTATGGAGCAACAGGGGAGGCTGGCGTTTCTCTTCTCCAAGAAGCTGCACAAAAGTGA...

CDS

Download CDS FASTA

798 bp · TkA02G513510|TK1151|CDS

ACACAGGGGAATTTTACTGGAATTCAGGCGGAAAACCCTATCGCTGTGACTGTGACCAAGGAAGCCGGCGGCTCAACCGTTGCTCCTGCTCACGTCAGTCGTCGGCGCAAGCCCTTGATGAAGAAGGGTAAGGGTGTGCATAAGAAGAAACGGATTTCCGATAGTGATGATGCGTTTGTTCCTCCTCCTCTCCCTCCAAATATTATGGAGCAACAGGGGAGGCTGGCGTTTCTCTTCTCCAAGAAGCTGCACAAAAGTGA...

Protein

Download Protein FASTA

266 aa · TkA02G513510|TK1151|PROTEIN

TQGNFTGIQAENPIAVTVTKEAGGSTVAPAHVSRRRKPLMKKGKGVHKKKRISDSDDAFVPPPLPPNIMEQQGRLAFLFSKKLHKSDVSNIGRIVLPKKPTEARLPVLLENDCIILPMKDIESGDAWSFKFRYWLNNRSRMYVLEGTGSFTKKHRLEAGDYMLLYQDLVNHNYVIRGVRASEYEEYEKQVRENKAREKDDDLMNQSLVGGFNDFDLFNLADQAPSMEDLSLMNDNSYFSDILNSFSSWDEFMTNNYPPIQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G513510`
TK1151 ID	TkA02G513510
OH-1004 ID	LXL04_023711
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	47.600
Protein coverage (%)	TK1151 73.308 / OH-1004 57.542 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G513510

Location Chr02:131848620-131851450 (+)

Description Similar to FUS3: B3 domain-containing transcription factor FUS3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g26790`	Transcription regulator involved in gene regulation during late embryogenesis.	The FUS3 transcription factor functions through the epidermal regulator TTG1 during embryogenesis in Arabidopsis.2004 · DOI: 10.1046/j.1365-313x.2003.01939.x The transcription factor FUSCA3 controls developmental timing in Arabidopsis through the hormones gibberellin and abscisic acid.2004 · DOI: 10.1016/j.devcel.2004.06.017 AKIN10 and FUSCA3 interact to control lateral organ development and phase transitions in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2011.04832.x Overlapping and distinct roles of AKIN10 and FUSCA3 in ABA and sugar signaling during seed germination.2012 · DOI: 10.4161/psb.21549
`At3g24650`	Participates in abscisic acid-regulated gene expression during seed development.	A pivotal role of the basic leucine zipper transcription factor bZIP53 in the regulation of Arabidopsis seed maturation gene expression based on heterodimerization and protein complex formation.2009 · DOI: 10.1105/tpc.108.062968 ABI3 controls embryo degreening through Mendel's I locus.2013 · DOI: 10.1073/pnas.1308114110

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0101000`	Transcription regulator involved in iron deficiency response and tolerance.	The transcription factor IDEF1 regulates the response to and tolerance of iron deficiency in plants.2007 · DOI: 10.1073/pnas.0707010104
`Os04g0676600`	Probable transcription regulator that binds specifically to the DNA sequence 5'-CATGC-3' of the IDE1 element found in the promoter of the barley iron deficiency-inducible gene IDS2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023711 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0009657 plastid organization Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009908 flower development Biological Process

GO:0010116 positive regulation of abscisic acid biosynthetic process Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

KEGG gene cross-reference

ath:AT3G24650

ath:AT3G26790

dosa:Os01g0713600

dosa:Os01g0911700

zma:542523

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.970

Rank 1 · TkA02G513510 · TK1151

Cytoplasm0.105

Rank 2 · TkA02G513510 · TK1151

Cell membrane0.025

Rank 3 · TkA02G513510 · TK1151

Endoplasmic reticulum0.017

Rank 4 · TkA02G513510 · TK1151

Plastid0.009

Rank 5 · TkA02G513510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02362B379-176 aa

PF07883Cupin_2142-177 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G513510	`PF02362`	B3	79	176	1e-11	45.4
TkA02G513510	`PF07883`	Cupin_2	142	177	0.26	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LW31`	Arabidopsis thaliana	sp\|Q9LW31\|FUS3_ARATH B3 domain-containing transcription factor FUS3	50.000%	Swiss-Prot	Low
`Q01593`	Arabidopsis thaliana	sp\|Q01593\|ABI3_ARATH B3 domain-containing transcription factor ABI3	49.100%	Swiss-Prot	Low
`Q6Z1Z3`	Oryza sativa subsp. japonica	sp\|Q6Z1Z3\|IDEF1_ORYSJ B3 domain-containing protein IDEF1	50.000%	Swiss-Prot	Low
`Q7XKC5`	Oryza sativa subsp. japonica	sp\|Q7XKC5\|IDEFH_ORYSJ B3 domain-containing protein Os04g0676600	46.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card