TkA02G508480 | RubberDandelionOmics

Gene overview

TkA02G508480

Reference: TK1151 Chr: Chr02 Coordinates: 130515163-130518062 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2117 bp · TkA02G508480|TK1151|cDNA

CTAAAACTTGTCCCCCAAGAAGTTTATCAAAACCACCAAAAGTTGTCCTTTTAACGTGTCTCTGGGTTTTTCTTCACGTTGGAATATCGTCTTACCTGTTCTTCATAATCAATTGACATAGCCTATACATCATCAAATTCGGATACTGGTCCAATCACTTTCAATATCTGGAGTTCGTTTCAGACCCAAAACCTCTACAGTCGATTGACCCCCGTCGTCTCCTTCCCCTCGTCCCGGTCTGTTCGTCTTACCATCGATGC...

CDS

Download CDS FASTA

1557 bp · TkA02G508480|TK1151|CDS

ATGGCAGGACTTGAAGAATTGAAAAAGAAACTCGTACCACTATTCGATGCAGAAAAGGGCTTTTCTTCAGGATCAACCATGGATCCCTCTGATTCGTACATGCTATCAGATGGCGGGACTGTCAACCTACTCAGCCGATCTTACGGAGTATACAACATCAACGAACTCGGATTACAAAAATGCACATCGAGACTCTCAAACGACGTAGACGAAAGAGAAAGGACTTACAGATGCGCTTCACACGAAATGAGAATATTTGG...

Protein

Download Protein FASTA

518 aa · TkA02G508480|TK1151|PROTEIN

MAGLEELKKKLVPLFDAEKGFSSGSTMDPSDSYMLSDGGTVNLLSRSYGVYNINELGLQKCTSRLSNDVDERERTYRCASHEMRIFGAIGSGASSVVQRAIHIPTHRIIALKKINIFEKEKRQQLLTEIRTLCEAPCYQGLVEFYGAFYTPDSGQISIALEYMDGGSLADVIKRQRCIPEAVLSLMVQKLLQGLSYLHGVRYLVHRDIKPANLLVNLKGEPKITDFGISAGLENSMAMCATFVGTVTYMSPERIRNESYS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G508480`
TK1151 ID	TkA02G508480
OH-1004 ID	LXL04_002378
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	48.200
Protein coverage (%)	TK1151 52.317 / OH-1004 77.684 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G508480

Location Chr02:130515163-130518062 (+)

Description Similar to MKK2: Mitogen-activated protein kinase kinase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40440`	MKK3-MPK6 module plays an important role in the jasmonate signal transduction pathway through the negative regulation of MYC2/JIN1 expression.	The mitogen-activated protein kinase cascade MKK3-MPK6 is an important part of the jasmonate signal transduction pathway in Arabidopsis.2007 · DOI: 10.1105/tpc.106.046581 The Arabidopsis mitogen-activated protein kinase kinase MKK3 is upstream of group C mitogen-activated protein kinases and participates in pathogen signaling.2007 · DOI: 10.1105/tpc.106.050039 Calmodulin-dependent activation of MAP kinase for ROS homeostasis in Arabidopsis.2011 · DOI: 10.1016/j.molcel.2011.02.029 Identification and characterization of an ABA-activated MAP kinase cascade in Arabidopsis thaliana.2015 · DOI: 10.1111/tpj.12808 The Arabidopsis Mitogen-Activated Protein Kinase Kinase Kinase 20 (MKKK20) Acts Upstream of MKK3 and MPK18 in Two Separate Signaling Pathways Involved in Root Microtubule Functions.2017 · DOI: 10.3389/fpls.2017.01352
`At5g56580`	The ANPs-MKK6-MPK4 module is involved in the regulation of plant cytokinesis during meiosis and mitosis.	NQK1/NtMEK1 is a MAPKK that acts in the NPK1 MAPKKK-mediated MAPK cascade and is required for plant cytokinesis.2003 · DOI: 10.1101/gad.1071103 The Arabidopsis thaliana MEK AtMKK6 activates the MAP kinase AtMPK13.2004 · DOI: 10.1016/j.febslet.2004.08.051 HINKEL kinesin, ANP MAPKKKs and MKK6/ANQ MAPKK, which phosphorylates and activates MPK4 MAPK, constitute a pathway that is required for cytokinesis in Arabidopsis thaliana.2010 · DOI: 10.1093/pcp/pcq135 The MAP kinase MPK4 is required for cytokinesis in Arabidopsis thaliana.2010 · DOI: 10.1105/tpc.110.077164 AtMPK4 is required for male-specific meiotic cytokinesis in Arabidopsis.2011 · DOI: 10.1111/j.1365-313x.2011.04642.x AtMKK6 and AtMPK13 are required for lateral root formation in Arabidopsis.2011 · DOI: 10.4161/psb.6.10.17089

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0510100`	Mitogen-activated protein kinase kinase 1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002378 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000165 MAPK cascade Biological Process

GO:0002229 defense response to oomycetes Biological Process

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009611 response to wounding Biological Process

GO:0009612 response to mechanical stimulus Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009875 pollen-pistil interaction Biological Process

KEGG gene cross-reference

ath:AT4G26070

ath:AT4G29810

dosa:Os01g0510100

nta:107818847

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.653

Rank 1 · TkA02G508480 · TK1151

Nucleus0.411

Rank 2 · TkA02G508480 · TK1151

Cell membrane0.086

Rank 3 · TkA02G508480 · TK1151

Mitochondrion0.066

Rank 4 · TkA02G508480 · TK1151

Golgi apparatus0.058

Rank 5 · TkA02G508480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase87-339 aa

PF07714PK_Tyr_Ser-Thr88-335 aa

PF11116DUF2624108-134 aa

PF03109ABC1158-235 aa

PF14531Kinase-like201-284 aa

PF02136NTF2369-459 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G508480	`PF00069`	Pkinase	87	339	1.5e-60	205.6
TkA02G508480	`PF07714`	PK_Tyr_Ser-Thr	88	335	1.3e-34	120.4
TkA02G508480	`PF11116`	DUF2624	108	134	0.18	13.4
TkA02G508480	`PF03109`	ABC1	158	235	0.00013	21.9
TkA02G508480	`PF14531`	Kinase-like	201	284	0.18	11.7
TkA02G508480	`PF02136`	NTF2	369	459	0.014	16.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80396`	Arabidopsis thaliana	sp\|O80396\|M2K3_ARATH Mitogen-activated protein kinase kinase 3	78.500%	Swiss-Prot	High
`Q9FJV0`	Arabidopsis thaliana	sp\|Q9FJV0\|M2K6_ARATH Mitogen-activated protein kinase kinase 6	42.000%	Swiss-Prot	Medium
`Q5QN75`	Oryza sativa subsp. japonica	sp\|Q5QN75\|M2K1_ORYSJ Mitogen-activated protein kinase kinase 1	41.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card