LXL04_002378 | RubberDandelionOmics

Gene overview

LXL04_002378

Reference: OH-1004 Chr: Chr01 Coordinates: 47522277-47525063 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1065 bp · LXL04_002378|LXL04_002378|OH1004|cDNA

ATGAATAAGGGAAATTTGGCCCCTTTTCTTAAGTTAAATCTCCCTCCACCTGATGAAACTTCTCTTGCTAAATTCTTGACTGAATCTGGGACGTTTATGGATGGTGATCTGCTAGTGAACAGGGATGGTGTTCGAATTGTTTCTCAAAGCCAATCGGAGACTCCACCTCTAATTCAGCCCTCAGACAACCAATTAAGCTTAGCCGATTTTGATGCGGTTAAAGTCGTTGGAAAGGGTAATGGTGGAATCGTTCGATTGGT...

CDS

Download CDS FASTA

1065 bp · LXL04_002378|LXL04_002378|OH1004|CDS

ATGAATAAGGGAAATTTGGCCCCTTTTCTTAAGTTAAATCTCCCTCCACCTGATGAAACTTCTCTTGCTAAATTCTTGACTGAATCTGGGACGTTTATGGATGGTGATCTGCTAGTGAACAGGGATGGTGTTCGAATTGTTTCTCAAAGCCAATCGGAGACTCCACCTCTAATTCAGCCCTCAGACAACCAATTAAGCTTAGCCGATTTTGATGCGGTTAAAGTCGTTGGAAAGGGTAATGGTGGAATCGTTCGATTGGT...

Protein

Download Protein FASTA

354 aa · LXL04_002378|LXL04_002378|OH1004|PROTEIN

MNKGNLAPFLKLNLPPPDETSLAKFLTESGTFMDGDLLVNRDGVRIVSQSQSETPPLIQPSDNQLSLADFDAVKVVGKGNGGIVRLVRHKWTEQFFALKVIQMNVEESARKQIAQELKINQSSQCPNVVVCYQSFYDNGAVSIILEYMDGGSLADFLKTVRSIPEPYLAAISKQVLRGLWYLHHEKHIIHRDLKPSNLLINHQGDVKITDFGVSAILASTSGLANTFVGTYNYMSPERIIGGSYGYKSDIWSLGLVLLEC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002378`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002378

Location Chr01:47522277-47525063 (+)

Description Similar to MKK2: Mitogen-activated protein kinase kinase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g29810`	MEKK1, MKK1/MKK2 and MPK4 function in a signaling pathway that modulates the expression of genes responding to biotic and abiotic stresses and also plays an important role in pathogen defense by negatively regulating innate immunity.	The MKK2 pathway mediates cold and salt stress signaling in Arabidopsis.2004 · DOI: 10.1016/j.molcel.2004.06.023 The MAP kinase kinase MKK2 affects disease resistance in Arabidopsis.2007 · DOI: 10.1094/mpmi-20-5-0589 Arabidopsis mitogen-activated protein kinase kinases MKK1 and MKK2 have overlapping functions in defense signaling mediated by MEKK1, MPK4, and MKS1.2008 · DOI: 10.1104/pp.108.120006
`At4g26070`	MEKK1, MKK1/MKK2 and MPK4/MPK6 function in a signaling pathway that modulates the expression of genes responding to biotic and abiotic stresses and also plays an important role in pathogen defense by negatively regulating innate immunity.	ATMPK4, an Arabidopsis homolog of mitogen-activated protein kinase, is activated in vitro by AtMEK1 through threonine phosphorylation.2000 · DOI: 10.1104/pp.122.4.1301 The Arabidopsis MAP kinase kinase MKK1 participates in defence responses to the bacterial elicitor flagellin.2006 · DOI: 10.1111/j.1365-313x.2006.02888.x AtMEK1 mediates stress-induced gene expression of CAT1 catalase by triggering H2O2 production in Arabidopsis.2007 · DOI: 10.1093/jxb/erm144 AtMKK1 mediates ABA-induced CAT1 expression and H2O2 production via AtMPK6-coupled signaling in Arabidopsis.2008 · DOI: 10.1111/j.1365-313x.2008.03433.x Arabidopsis mitogen-activated protein kinase kinases MKK1 and MKK2 have overlapping functions in defense signaling mediated by MEKK1, MPK4, and MKS1.2008 · DOI: 10.1104/pp.108.120006 AtMKK1 and AtMPK6 are involved in abscisic acid and sugar signaling in Arabidopsis seed germination.2009 · DOI: 10.1007/s11103-009-9503-0

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0510100`	Mitogen-activated protein kinase kinase 1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002378 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000165 MAPK cascade Biological Process

GO:0002229 defense response to oomycetes Biological Process

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009611 response to wounding Biological Process

GO:0009612 response to mechanical stimulus Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009875 pollen-pistil interaction Biological Process

KEGG gene cross-reference

ath:AT4G26070

ath:AT4G29810

dosa:Os01g0510100

nta:107818847

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.683

Rank 1 · LXL04_002378 · OH-1004

Nucleus0.531

Rank 2 · LXL04_002378 · OH-1004

Cell membrane0.065

Rank 3 · LXL04_002378 · OH-1004

Mitochondrion0.051

Rank 4 · LXL04_002378 · OH-1004

Endoplasmic reticulum0.044

Rank 5 · LXL04_002378 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase72-330 aa

PF07714.24PK_Tyr_Ser-Thr73-326 aa

PF03109.23ABC1141-217 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002378	`PF00069.32`	Pkinase	72	330	6.3e-70	236.3
LXL04_002378	`PF07714.24`	PK_Tyr_Ser-Thr	73	326	1.8e-39	136.3
LXL04_002378	`PF03109.23`	ABC1	141	217	3.6e-06	27.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7U9`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase 2	68.362%	Swiss-Prot	strong database homology
`Q94A06`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase 1	64.789%	Swiss-Prot	strong database homology
`Q5QN75`	Oryza sativa subsp. japonica	Mitogen-activated protein kinase kinase 1	59.760%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card