TkA02G503430 | RubberDandelionOmics

Gene overview

TkA02G503430

Reference: TK1151 Chr: Chr02 Coordinates: 129096166-129099434 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2183 bp · TkA02G503430|TK1151|cDNA

CTGAATATAGAGATACAACATTATATTTATACCCACTACTATATAGTGAGAGAAAGTGATAGAAAGAAGAGGGGTCCATGTTCCTCAACCGCATGACATCCAATTGAAGTTTGTTTGTAGGAGTGGCAACCTAGGGTTCTAAGTCGATTGGTTTTCAGATAATTTAAGTTGGAACATATCTTTTAGTCAACAATGGGAAAATCTCCTGGAAAGTGGATCAAGACTGTATTTTTGGGGAAGAAGTCATCATCCAAATCTAA...

CDS

Download CDS FASTA

1644 bp · TkA02G503430|TK1151|CDS

ATGGGAAAATCTCCTGGAAAGTGGATCAAGACTGTATTTTTGGGGAAGAAGTCATCATCCAAATCTAATCTCTCAAAAGATGCTACTTCAGAAATTAAAGTATCCATCACTGGTAAAACACCATCAGACAATTTTGGTGCTGATTCAATGATCATCTCAAGTCCAGTACGCCCTGTAATTGATTCAAATGATCATACAGAGCTTGAAAACAGCTCAAGTGCCAACTTAATAACAGATACCCCTGAAACTCCAACAACTCC...

Protein

Download Protein FASTA

547 aa · TkA02G503430|TK1151|PROTEIN

MGKSPGKWIKTVFLGKKSSSKSNLSKDATSEIKVSITGKTPSDNFGADSMIISSPVRPVIDSNDHTELENSSSANLITDTPETPTTPIDLTAMTGDDLIKLEQAATKAQAAFRGYLARRAFWALKGIIRLQALVRGHLVRRQAVATLKCMRAIVEFQALVRGQKVRLSGSGPPRQLLNKKPSELLQKSIREERLSTNNFATKLVVSSNTTIPLSFQYEPNDPNSVKNWLERWSISHFWDPLPQPKKAPDSKPKRKQQTKP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G503430`
TK1151 ID	TkA02G503430
OH-1004 ID	LXL04_013352
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.500
Protein coverage (%)	TK1151 98.355 / OH-1004 96.774 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G503430

Location Chr02:129096166-129099434 (-)

Description Similar to IQD31: Protein IQ-DOMAIN 31

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74690`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At2g02790`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At1g18840`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At1g14380`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At3g22190`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	The Microtubule-Associated Protein IQ67 DOMAIN5 Modulates Microtubule Dynamics and Pavement Cell Shape.2018 · DOI: 10.1104/pp.18.00558 Microtubule-associated protein IQ67 DOMAIN5 regulates morphogenesis of leaf pavement cells in Arabidopsis thaliana.2019 · DOI: 10.1093/jxb/ery395

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013352 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005875 microtubule associated complex Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT1G14380

ath:AT1G18840

ath:AT1G74690

ath:AT2G02790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.432

Rank 1 · TkA02G503430 · TK1151

Cell membrane0.373

Rank 2 · TkA02G503430 · TK1151

Nucleus0.326

Rank 3 · TkA02G503430 · TK1151

Endoplasmic reticulum0.051

Rank 4 · TkA02G503430 · TK1151

Golgi apparatus0.032

Rank 5 · TkA02G503430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00612IQ103-121 aa

PF00612IQ125-142 aa

PF00612IQ151-166 aa

PF13178DUF4005249-292 aa

PF13178DUF4005437-529 aa

PF00612IQ540-546 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G503430	`PF00612`	IQ	103	121	3.2e-10	39.6
TkA02G503430	`PF00612`	IQ	125	142	3.2e-10	39.6
TkA02G503430	`PF00612`	IQ	151	166	3.2e-10	39.6
TkA02G503430	`PF13178`	DUF4005	249	292	2.6e-09	38.3
TkA02G503430	`PF13178`	DUF4005	437	529	2.6e-09	38.3
TkA02G503430	`PF00612`	IQ	540	546	3.2e-10	39.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L4D8`	Arabidopsis thaliana	sp\|Q8L4D8\|IQD31_ARATH Protein IQ-DOMAIN 31	36.100%	Swiss-Prot	Medium
`A0A1P8B0B7`	Arabidopsis thaliana	sp\|A0A1P8B0B7\|IQD29_ARATH Protein IQ-DOMAIN 29	32.400%	Swiss-Prot	Medium
`Q501D2`	Arabidopsis thaliana	sp\|Q501D2\|IQD30_ARATH Protein IQ-DOMAIN 30	42.900%	Swiss-Prot	Medium
`Q8GZ87`	Arabidopsis thaliana	sp\|Q8GZ87\|IQD28_ARATH Protein IQ-DOMAIN 28	43.100%	Swiss-Prot	Low
`F4J061`	Arabidopsis thaliana	sp\|F4J061\|IQD5_ARATH Protein IQ-DOMAIN 5	37.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card