LXL04_013352 | RubberDandelionOmics

Gene overview

LXL04_013352

Reference: OH-1004 Chr: Chr03 Coordinates: 28265492-28267616 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1677 bp · LXL04_013352|LXL04_013352|OH1004|cDNA

ATGGGGAAATCTCCTGGAAAGTGGATCAAGACTGTATTTTTGGGGAAGAAGTCATCATCCAAATCTAATCTCTCAAAAGATGCTACTTCAGAAATTAAAGTATCCGTCACTGGTAAAACACCATCAGACAATTTTGGTGCTGATTCAATGATCATCTCAAGTCCAGTACGCCCTGTAATTGATTCAAATGATCATACAGAGCTTGAAAACAGCTCCAGTGCCAACTTAATAACAGATACCCCTGAAACTCCAACAACTCC...

CDS

Download CDS FASTA

1677 bp · LXL04_013352|LXL04_013352|OH1004|CDS

ATGGGGAAATCTCCTGGAAAGTGGATCAAGACTGTATTTTTGGGGAAGAAGTCATCATCCAAATCTAATCTCTCAAAAGATGCTACTTCAGAAATTAAAGTATCCGTCACTGGTAAAACACCATCAGACAATTTTGGTGCTGATTCAATGATCATCTCAAGTCCAGTACGCCCTGTAATTGATTCAAATGATCATACAGAGCTTGAAAACAGCTCCAGTGCCAACTTAATAACAGATACCCCTGAAACTCCAACAACTCC...

Protein

Download Protein FASTA

558 aa · LXL04_013352|LXL04_013352|OH1004|PROTEIN

MGKSPGKWIKTVFLGKKSSSKSNLSKDATSEIKVSVTGKTPSDNFGADSMIISSPVRPVIDSNDHTELENSSSANLITDTPETPTTPIDLTAMTGDDLIKLEQAATKAQAAFRGYLARRAFWALKGIIRLQALVRGHLVRRQAVATLKCMRAIVEFQALVRGQKVRLSGSGQPHPPRQLLNKKPSELLLKSIREEKLSTNKFATKLVVSSNTTIPLSFQYEPNDPNSVKNWLERWSISHFWDPLPQPKKAPDSKPKRKQQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013352`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013352

Location Chr03:28265492-28267616 (+)

Description Similar to IQD31: Protein IQ-DOMAIN 31

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74690`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At1g18840`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At2g02790`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At1g14380`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At1g19870`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013352 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005875 microtubule associated complex Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT1G14380

ath:AT1G18840

ath:AT1G74690

ath:AT2G02790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.434

Rank 1 · LXL04_013352 · OH-1004

Cell membrane0.365

Rank 2 · LXL04_013352 · OH-1004

Nucleus0.326

Rank 3 · LXL04_013352 · OH-1004

Endoplasmic reticulum0.054

Rank 4 · LXL04_013352 · OH-1004

Golgi apparatus0.033

Rank 5 · LXL04_013352 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00612.34IQ103-121 aa

PF13178.12DUF4005441-531 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013352	`PF00612.34`	IQ	103	121	2.8e-11	42.9
LXL04_013352	`PF13178.12`	DUF4005	441	531	4.4e-09	37.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L4D8`	Arabidopsis thaliana	Protein IQ-DOMAIN 31	36.000%	Swiss-Prot	moderate database homology
`Q501D2`	Arabidopsis thaliana	Protein IQ-DOMAIN 30	36.565%	Swiss-Prot	moderate database homology
`A0A1P8B0B7`	Arabidopsis thaliana	Protein IQ-DOMAIN 29	33.203%	Swiss-Prot	moderate database homology
`Q8GZ87`	Arabidopsis thaliana	Protein IQ-DOMAIN 28	34.100%	Swiss-Prot	moderate database homology
`Q9FXI5`	Arabidopsis thaliana	Protein IQ-DOMAIN 32	41.844%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card