TkA02G502160 | RubberDandelionOmics

Gene overview

TkA02G502160

Reference: TK1151 Chr: Chr02 Coordinates: 128705243-128707418 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

894 bp · TkA02G502160|TK1151|cDNA

TTTGAAAGAGCGGTTGATACTTGATATTGCCTCCTATTCATTTGAACAATCACAAACCATGAAGGGGCAAGGGGAGATTTCGTAATTACGTGTTCTACCATCATTCGTTTCATGAATTTGGCGGGTGGGAATATTTTTAACTGTTTATTCCCAATAATGGGACACACCTACACAGATCGAAAGGGATAAGTACGTGATGAAGAAGAACGCATCAAATTGACAAGTTGGGCAAAAAGATCGATGCAATTTAGGCGGTTTGT...

CDS

Download CDS FASTA

654 bp · TkA02G502160|TK1151|CDS

ATGCAATTTAGGCGGTTTGTTCGAGATCATCAAAAGGATTCCTCGCTTTCGCTGCAACGTTCTCCGTCAGTTCAGTATACCATTACCACACCAAAGTGGCGTCAGCTTATGAACAAATTAGGTTTTATGCAGAAGCCTAATTTTTTCAAAGTTACCCACTCTTATCCTTCTTCTGTAATCTCCTGCATACACAACCCACCACATGATGATGCAGAGGTTTCACGAATCACAAGTTCAAGTTCACAAAATAGACATCCAAA...

Protein

Download Protein FASTA

217 aa · TkA02G502160|TK1151|PROTEIN

MQFRRFVRDHQKDSSLSLQRSPSVQYTITTPKWRQLMNKLGFMQKPNFFKVTHSYPSSVISCIHNPPHDDAEVSRITSSSSQNRHPKCAVNESTTSNVLKDVHILAFNYYVNTTSVDKTHLLDGFLDLAKDNTSKDLETCGVLGAFLKEGTYYVTTLIIPKQESTSSTCQAVNEEEIFAIQNEQSLFPVGWIHTHPSQSCLCHPSICILNILIRYYI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G502160`
TK1151 ID	TkA02G502160
OH-1004 ID	LXL04_011575
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.500
Protein coverage (%)	TK1151 92.166 / OH-1004 67.509 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G502160

Location Chr02:128705243-128707418 (+)

Description Similar to AMSH2: AMSH-like ubiquitin thioesterase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10600`	Zinc metalloprotease that cleaves 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.	No verified direct reference in this release
`At1g48790`	Zinc metalloprotease that cleaves 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.	No verified direct reference in this release
`At4g16144`	Zinc metalloprotease that cleaves 'Lys-48'- and 'Lys-63'- linked polyubiquitin chains, but is not implicated in protein degradation by the 26S proteasome, deneddylation, or desumoylation.	The deubiquitinating enzyme AMSH3 is required for intracellular trafficking and vacuole biogenesis in Arabidopsis thaliana.2010 · DOI: 10.1105/tpc.110.075952

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011575 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006897 endocytosis Biological Process

GO:0007033 vacuole organization Biological Process

GO:0015031 protein transport Biological Process

GO:0032511 late endosome to vacuole transport via multivesicular body sorting pathway Biological Process

GO:0043328 protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway Biological Process

GO:0044090 positive regulation of vacuole organization Biological Process

GO:0045324 late endosome to vacuole transport Biological Process

GO:0070536 protein K63-linked deubiquitination Biological Process

GO:0071108 protein K48-linked deubiquitination Biological Process

GO:0090316 positive regulation of intracellular protein transport Biological Process

GO:0120113 cytoplasm to vacuole targeting by the NVT pathway Biological Process

KEGG gene cross-reference

ath:AT1G10600

ath:AT1G48790

ddi:DDB_G0284037

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.480

Rank 1 · TkA02G502160 · TK1151

Nucleus0.328

Rank 2 · TkA02G502160 · TK1151

Mitochondrion0.124

Rank 3 · TkA02G502160 · TK1151

Cell membrane0.123

Rank 4 · TkA02G502160 · TK1151

Golgi apparatus0.110

Rank 5 · TkA02G502160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01398JAB123-205 aa

PF14464Prok-JAB132-198 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G502160	`PF01398`	JAB	123	205	1.7e-09	38.2
TkA02G502160	`PF14464`	Prok-JAB	132	198	0.0071	16.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NKP9`	Arabidopsis thaliana	sp\|Q6NKP9\|AMSH2_ARATH AMSH-like ubiquitin thioesterase 2	51.300%	Swiss-Prot	Medium
`Q8VYB5`	Arabidopsis thaliana	sp\|Q8VYB5\|AMSH1_ARATH AMSH-like ubiquitin thioesterase 1	51.300%	Swiss-Prot	Medium
`Q5PNU3`	Arabidopsis thaliana	sp\|Q5PNU3\|AMSH3_ARATH AMSH-like ubiquitin thioesterase 3	62.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card