Gene Card
Gene overview
cDNA / CDS / Protein Sequences
576 bp · TkA02G502020|TK1151|cDNA
ATGGCGATTTCAACAAACTCTCCGGAGAAAACAACTTCAGAACAACCTAACCCCACCCAACAACCCGCTCCTGATAATCCGAATCCACCAAACCCGGATCTACCGAATTCATCTGCTGCACCACCATCTGCAACTCCCGCCACCACCGTTAACGCCACAGTAGTAACAGTAAACCCTAACCTTACCCTTAATAATTCACATCCAACACTATCGCAGCCAACGGACTTAACGCCGCCGCCGCAGATCCAATCCTTTGTACT...
576 bp · TkA02G502020|TK1151|CDS
ATGGCGATTTCAACAAACTCTCCGGAGAAAACAACTTCAGAACAACCTAACCCCACCCAACAACCCGCTCCTGATAATCCGAATCCACCAAACCCGGATCTACCGAATTCATCTGCTGCACCACCATCTGCAACTCCCGCCACCACCGTTAACGCCACAGTAGTAACAGTAAACCCTAACCTTACCCTTAATAATTCACATCCAACACTATCGCAGCCAACGGACTTAACGCCGCCGCCGCAGATCCAATCCTTTGTACT...
Protein
Download Protein FASTA191 aa · TkA02G502020|TK1151|PROTEIN
MAISTNSPEKTTSEQPNPTQQPAPDNPNPPNPDLPNSSAAPPSATPATTVNATVVTVNPNLTLNNSHPTLSQPTDLTPPPQIQSFVLPSQVSTFPPSYRPPGCRYLFKLPLSFLQYRTLLSRTTEFKSRPGPGPGPCSAARCDDAAALSGKRAMSSIPQMMPPQYGQPGQQPIRMYAPMPNGYQMAPPQAQ
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G502020 |
|---|---|
| TK1151 ID | TkA02G502020 |
| OH-1004 ID | LXL04_011569 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 74.000 |
| Protein coverage (%) | TK1151 98.953 / OH-1004 19.730Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G502020 |
|---|---|
| Location | Chr02:128663097-128663672 (-) |
| Description | Similar to RBM25: RNA-binding protein 25 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process GO:0000395 mRNA 5'-splice site recognition Biological Process GO:0006397 mRNA processing Biological Process GO:0008380 RNA splicing Biological Process GO:0009414 response to water deprivation Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0048024 regulation of mRNA splicing, via spliceosome Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005685 U1 snRNP Cellular Component GO:0005737 cytoplasm Cellular Component |
| KEGG gene cross-reference | ath:AT1G60200 hsa:58517 mmu:67039 spo:2541211 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.