LXL04_011569 | RubberDandelionOmics

Gene overview

LXL04_011569

Reference: OH-1004 Chr: Chr02 Coordinates: 167470593-167475464 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2892 bp · LXL04_011569|LXL04_011569|OH1004|cDNA

ATGGCGATTTCAACAAACTCTCCGGAGAAAACAACTTCAGAACAACCTAACCCCACCCAACAACCCGCTCCTGATAATCCGAATCCACCAAACCCGGATCTACCGAATTCATCTGCTGCACCACCATCTGCAACTCCCGCCACCACCGTTAACGCCACAGTAGTAACAGTAAACCCTAACCTTACCCTTAATAATTCACATCCAACACTATCGCAGCCAACGGACTTAACGCCGCCGCCGCAGATCCAATCCTTTGTACT...

CDS

Download CDS FASTA

2892 bp · LXL04_011569|LXL04_011569|OH1004|CDS

ATGGCGATTTCAACAAACTCTCCGGAGAAAACAACTTCAGAACAACCTAACCCCACCCAACAACCCGCTCCTGATAATCCGAATCCACCAAACCCGGATCTACCGAATTCATCTGCTGCACCACCATCTGCAACTCCCGCCACCACCGTTAACGCCACAGTAGTAACAGTAAACCCTAACCTTACCCTTAATAATTCACATCCAACACTATCGCAGCCAACGGACTTAACGCCGCCGCCGCAGATCCAATCCTTTGTACT...

Protein

Download Protein FASTA

963 aa · LXL04_011569|LXL04_011569|OH1004|PROTEIN

MAISTNSPEKTTSEQPNPTQQPAPDNPNPPNPDLPNSSAAPPSATPATTVNATVVTVNPNLTLNNSHPTLSQPTDLTPPPQIQSFVLPSQVSTFPPSYRPPGLSVPIQTTPQFSPIPNALIQNYGVQGQGQVQVQVHVQPPGVMMQPPSQASGAMSSIPQMMPPQYGQPGQQPIRMYAPMPNGYQMAPPQGTMNPPGGSFIFSLYWLCLFSFGVYNRLAVDCPLLIDVMVRKIGRLSSISRFFRDHYSHNFFGILRYAPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011569`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011569

Location Chr02:167470593-167475464 (-)

Description Similar to RBM25: RNA-binding protein 25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60200`	RNA-binding protein that acts as a regulator of alternative pre-mRNA splicing.	An Arabidopsis PWI and RRM motif-containing protein is critical for pre-mRNA splicing and ABA responses.2015 · DOI: 10.1038/ncomms9139 A Genetic Screen for Pre-mRNA Splicing Mutants of Arabidopsis thaliana Identifies Putative U1 snRNP Components RBM25 and PRP39a.2017 · DOI: 10.1534/genetics.117.300149

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011569 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process

GO:0000395 mRNA 5'-splice site recognition Biological Process

GO:0006397 mRNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0048024 regulation of mRNA splicing, via spliceosome Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005685 U1 snRNP Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G60200

hsa:58517

mmu:67039

spo:2541211

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.957

Rank 1 · LXL04_011569 · OH-1004

Cytoplasm0.134

Rank 2 · LXL04_011569 · OH-1004

Cell membrane0.019

Rank 3 · LXL04_011569 · OH-1004

Mitochondrion0.010

Rank 4 · LXL04_011569 · OH-1004

Endoplasmic reticulum0.009

Rank 5 · LXL04_011569 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076.29RRM_1317-386 aa

PF01480.23PWI885-948 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011569	`PF00076.29`	RRM_1	317	386	1.6e-09	38.2
LXL04_011569	`PF01480.23`	PWI	885	948	8.7e-15	55.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VY15`	Arabidopsis thaliana	RNA-binding motif protein 25	48.196%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card