TkA02G501560 | RubberDandelionOmics

Gene overview

TkA02G501560

Reference: TK1151 Chr: Chr02 Coordinates: 128516962-128518962 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1038 bp · TkA02G501560|TK1151|cDNA

ATTGAAGGTCTGCATTGGTGGAAAGGATGCCGGTTCTAGATGAAGCAACATACGGTGGAAGACGAGGTGGCGGTGTGTCCAGCTCAGCAATGGGAAAGGGAATGAATAACAGTATTCCAAATGGGGTAGTTAAAGTAGTTGATGCTCCTCTTGTAGACTTGCTTGATTTAGGTGTAGACGAACCTTCCGCACCTCCACCTAATAACTCTACACCTGCCAACAATTTCCTTCACGACCTTCTCGGTGTTGACATCTCATCA...

CDS

Download CDS FASTA

942 bp · TkA02G501560|TK1151|CDS

ATGCCGGTTCTAGATGAAGCAACATACGGTGGAAGACGAGGTGGCGGTGTGTCCAGCTCAGCAATGGGAAAGGGAATGAATAACAGTATTCCAAATGGGGTAGTTAAAGTAGTTGATGCTCCTCTTGTAGACTTGCTTGATTTAGGTGTAGACGAACCTTCCGCACCTCCACCTAATAACTCTACACCTGCCAACAATTTCCTTCACGACCTTCTCGGTGTTGACATCTCATCATCATCATCTCCATCACAATCAGGGAC...

Protein

Download Protein FASTA

313 aa · TkA02G501560|TK1151|PROTEIN

MPVLDEATYGGRRGGGVSSSAMGKGMNNSIPNGVVKVVDAPLVDLLDLGVDEPSAPPPNNSTPANNFLHDLLGVDISSSSSPSQSGTMHNVQKSGTDVLLDLLSTGSPSAFTPAQKSSSASDLLSLTQINTNTNTNNKGSVLGGLDSLTLSSVHASSPTTARASPSPSPMNMMDLLDGFGPANTPPPPKDNGPAYPPIVAFESASLRLTFNFSKQPATPHVTDIEASFANKSSHLFTDFIFQAAVPKFLQLHLEPASSNT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G501560`
TK1151 ID	TkA02G501560
OH-1004 ID	LXL04_011561
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 34.701 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G501560

Location Chr02:128516962-128518962 (+)

Description Similar to At1g60070: AP-1 complex subunit gamma-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60070`	Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting at the trans-Golgi network and early endosomes (TGN/EE).	No verified direct reference in this release
`At1g23900`	Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting at the trans-Golgi network and early endosomes (TGN/EE).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011561 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006896 Golgi to vacuole transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0032438 melanosome organization Biological Process

GO:0035646 endosome to melanosome transport Biological Process

GO:0060155 platelet dense granule organization Biological Process

GO:0090160 Golgi to lysosome transport Biological Process

GO:0110010 basolateral protein secretion Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005765 lysosomal membrane Cellular Component

KEGG gene cross-reference

ath:AT1G23900

ath:AT1G60070

hsa:164

mmu:11765

pon:100173736

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.638

Rank 1 · TkA02G501560 · TK1151

Golgi apparatus0.341

Rank 2 · TkA02G501560 · TK1151

Nucleus0.164

Rank 3 · TkA02G501560 · TK1151

Endoplasmic reticulum0.095

Rank 4 · TkA02G501560 · TK1151

Cell membrane0.089

Rank 5 · TkA02G501560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02883Alpha_adaptinC2196-310 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G501560	`PF02883`	Alpha_adaptinC2	196	310	4.3e-32	111.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUI6`	Arabidopsis thaliana	sp\|Q9ZUI6\|AP1G2_ARATH AP-1 complex subunit gamma-2	51.300%	Swiss-Prot	High
`Q84K16`	Arabidopsis thaliana	sp\|Q84K16\|AP1G1_ARATH AP-1 complex subunit gamma-1	53.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card