RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G495250
Reference: TK1151 Chr: Chr02 Coordinates: 126790994-126792983 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1483 bp · TkA02G495250|TK1151|cDNA

ATTTTATCACCCACTAATTATTTTCCACGTGTCACCTTCTGGATTCTCCTCCGCCTCCCACTTGTTACTTTGCTTCTTTATTGTGACCACAAAACTGAACTCAAAAACTACACGAACCACACAATCACAAACCCAACACACAGAATGTTGGATCAGAGCAGTATCTTAGGCTTAAAAAGTAGTACCACCTGGGCTCGCGTCTGCGACACCTGCCGCTCCGCCCCCTGCACCATCTACTGCCGCCCTGACAACGCCTACCT...

CDS

Download CDS FASTA

1284 bp · TkA02G495250|TK1151|CDS

ATTTTATCACCCACTAATTATTTTCCACGTGTCACCTTCTGGATTCTCCTCCGCCTCCCACTTGTTACTTTGCTTCTTTATTGTGACCACAAAACTGAACTCAAAAACTACACGAACCACACAATCACAAACCCAACACACAGAATGTTGGATCAGAGCAGTATCTTAGGCTTAAAAAGTAGTACCACCTGGGCTCGCGTCTGCGACACCTGCCGCTCCGCCCCCTGCACCATCTACTGCCGCCCTGACAACGCCTACCT...

Protein

Download Protein FASTA

427 aa · TkA02G495250|TK1151|PROTEIN

ILSPTNYFPRVTFWILLRLPLVTLLLYCDHKTELKNYTNHTITNPTHRMLDQSSILGLKSSTTWARVCDTCRSAPCTIYCRPDNAYLCTACDARIHAANKLQSSQHERVWVCEACEQAPAAFICKADNASLCTTCDADIHSANPLARRHHRVPVMPIPGALYGPHAADPRTVMGLGVESQSGFLSHDGEDAIDDEDEDEAASWLLFDGPPPKNSQNQNGKDNELLFHGDQGGEDEYLEFMEFGEDQQQCYKVTEKMYGGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G495250
TK1151 IDTkA02G495250
OH-1004 IDLXL04_028931
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)42.300
Protein coverage (%)TK1151 84.543 / OH-1004 97.051
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G495250
LocationChr02:126790994-126792983 (+)
DescriptionSimilar to COL4: Zinc finger protein CONSTANS-LIKE 4
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g02380 Putative transcription factor. No verified direct reference in this release
At5g15850 Putative transcription factor that may be involved in the light input to the circadian clock but does not affect flowering time. No verified direct reference in this release
At5g15840 Transcription factor that acts in the long day flowering pathway and may mediate between the circadian clock and the control of flowering. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os09g0240200 Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. No verified direct reference in this release
Os06g0275000 Probable transcription factor involved in the regulation of flower development. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_028931 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0007623 circadian rhythm Biological Process
GO:0009658 chloroplast organization Biological Process
GO:0009909 regulation of flower development Biological Process
GO:0010099 regulation of photomorphogenesis Biological Process
GO:0010161 red light signaling pathway Biological Process
GO:0032922 circadian regulation of gene expression Biological Process
GO:2000028 regulation of photoperiodism, flowering Biological Process
GO:0005634 nucleus Cellular Component
GO:0016607 nuclear speck Cellular Component
GO:0000976 transcription cis-regulatory region binding Molecular Function
KEGG gene cross-reference
ath:AT2G24790
ath:AT3G02380
ath:AT5G15850
ath:AT5G24930
ath:AT5G57660
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.839
Rank 1 · TkA02G495250 · TK1151
Cytoplasm0.216
Rank 2 · TkA02G495250 · TK1151
Cell membrane0.056
Rank 3 · TkA02G495250 · TK1151
Endoplasmic reticulum0.051
Rank 4 · TkA02G495250 · TK1151
Lysosome / Vacuole0.017
Rank 5 · TkA02G495250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09963DUF219728-38 aa
PF03107C1_261-97 aa
PF00643zf-B_box66-107 aa
PF22586ANCHR-like_BBOX67-106 aa
PF16366CEBP_ZZ67-106 aa
PF09963DUF219781-98 aa
PF03107C1_2102-135 aa
PF09963DUF2197107-117 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G495250PF09963DUF219728380.3611.9
TkA02G495250PF03107C1_261970.06314.3
TkA02G495250PF00643zf-B_box661075.5e-1246.4
TkA02G495250PF22586ANCHR-like_BBOX671060.001419.4
TkA02G495250PF16366CEBP_ZZ671060.04214.8
TkA02G495250PF09963DUF219781980.3611.9
TkA02G495250PF03107C1_21021350.06314.3
TkA02G495250PF09963DUF21971071170.3611.9
TkA02G495250PF00643zf-B_box1081545.5e-1246.4
TkA02G495250PF22586ANCHR-like_BBOX1111510.001419.4
TkA02G495250PF16366CEBP_ZZ1111500.04214.8
TkA02G495250PF09963DUF21971311400.3611.9
TkA02G495250PF06203CCT3584008.1e-1864.9
TkA02G495250PF02045CBFB_NFYA3644060.2912.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q96502Arabidopsis thalianasp|Q96502|COL2_ARATH Zinc finger protein CONSTANS-LIKE 252.500%Swiss-ProtHigh
O50055Arabidopsis thalianasp|O50055|COL1_ARATH Zinc finger protein CONSTANS-LIKE 150.100%Swiss-ProtHigh
Q39057Arabidopsis thalianasp|Q39057|CONS_ARATH Zinc finger protein CONSTANS45.500%Swiss-ProtMedium
O82117Oryza sativa subsp. japonicasp|O82117|CO3_ORYSJ Zinc finger protein CO336.100%Swiss-ProtMedium
Q9FDX8Oryza sativa subsp. japonicasp|Q9FDX8|HD1_ORYSJ Zinc finger protein HD140.100%Swiss-ProtMedium

JBrowse

View in Genome Browser