TkA02G482880 | RubberDandelionOmics

Gene overview

TkA02G482880

Reference: TK1151 Chr: Chr02 Coordinates: 123211832-123212416 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

552 bp · TkA02G482880|TK1151|cDNA

ATGTTGTCTTCTGTCTTTCCCGCCGCCGGCGACCGTATTCCGTCCGACGACTTTCTTGGAACCGGGTTCACCCCCTGGGACACTGACACGCAAGAAAGCCCCTTCGTATACCCATCTCAAGAACCGGTATTTTCGTTTTCCGGTTCCGACGACTCCACACCGAAAACCAATAGCTCCAACTCCGGCTCCGACGAGGGAGACGTTGATGAACGTAAGCGGAGACGCATGATATCAAACCGGGAGTCGGCACGGCGATCCCG...

CDS

Download CDS FASTA

552 bp · TkA02G482880|TK1151|CDS

ATGTTGTCTTCTGTCTTTCCCGCCGCCGGCGACCGTATTCCGTCCGACGACTTTCTTGGAACCGGGTTCACCCCCTGGGACACTGACACGCAAGAAAGCCCCTTCGTATACCCATCTCAAGAACCGGTATTTTCGTTTTCCGGTTCCGACGACTCCACACCGAAAACCAATAGCTCCAACTCCGGCTCCGACGAGGGAGACGTTGATGAACGTAAGCGGAGACGCATGATATCAAACCGGGAGTCGGCACGGCGATCCCG...

Protein

Download Protein FASTA

183 aa · TkA02G482880|TK1151|PROTEIN

MLSSVFPAAGDRIPSDDFLGTGFTPWDTDTQESPFVYPSQEPVFSFSGSDDSTPKTNSSNSGSDEGDVDERKRRRMISNRESARRSRMRKQKHLENLRNQVNRHKTANRELMNQLRFVSHHGQVLQQENERLRSESAMLRQKLWDMRQVLLVRQLQNQLLSSAWPCNNNMTSINEQNPPSLIT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G482880`
TK1151 ID	TkA02G482880
OH-1004 ID	LXL04_013636
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G482880

Location Chr02:123211832-123212416 (-)

Description Similar to BZIP43: Basic leucine zipper 43

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g59530`	Probable transcription factor involved in somatic embryogenesis.	Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.2016 · DOI: 10.1016/j.jplph.2016.02.012
`At5g38800`	Probable transcription factor involved in somatic embryogenesis.	Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.2016 · DOI: 10.1016/j.jplph.2016.02.012
`At1g75390`	Transcription factor that binds to the DNA G-box motif 5'- CACGTG-3' of MAN7 promoter.	Arabidopsis thaliana bZIP44: a transcription factor affecting seed germination and expression of the mannanase-encoding gene AtMAN7.2013 · DOI: 10.1111/tpj.12162
`At3g62420`	May bind specific sequences in target-gene promoters and activate transcription.	A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis.2004 · DOI: 10.1093/pcp/pch036 Combinatorial control of Arabidopsis proline dehydrogenase transcription by specific heterodimerisation of bZIP transcription factors.2006 · DOI: 10.1038/sj.emboj.7601206 A pivotal role of the basic leucine zipper transcription factor bZIP53 in the regulation of Arabidopsis seed maturation gene expression based on heterodimerization and protein complex formation.2009 · DOI: 10.1105/tpc.108.062968 Heterodimers of the Arabidopsis transcription factors bZIP1 and bZIP53 reprogram amino acid metabolism during low energy stress.2011 · DOI: 10.1105/tpc.110.075390 A novel method to identify the DNA motifs recognized by a defined transcription factor.2014 · DOI: 10.1007/s11103-014-0234-5
`At2g18160`	Transcription factor that binds to specific DNA sequences in target gene promoters.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013636 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006971 hypotonic response Biological Process

GO:0009267 cellular response to starvation Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009845 seed germination Biological Process

GO:0017148 negative regulation of translation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0080149 sucrose induced translational repression Biological Process

GO:2000693 positive regulation of seed maturation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G75390

ath:AT2G18160

ath:AT3G62420

ath:AT4G34590

ath:AT5G38800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.979

Rank 1 · TkA02G482880 · TK1151

Cytoplasm0.086

Rank 2 · TkA02G482880 · TK1151

Cell membrane0.020

Rank 3 · TkA02G482880 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA02G482880 · TK1151

Plastid0.009

Rank 5 · TkA02G482880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF31042DUF878237-121 aa

PF09726Macoilin48-148 aa

PF24126DUF739467-99 aa

PF07716bZIP_269-115 aa

PF13863DUF420070-127 aa

PF00170bZIP_171-129 aa

PF03131bZIP_Maf71-132 aa

PF30842LEKR175-150 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G482880	`PF31042`	DUF8782	37	121	0.17	12.6
TkA02G482880	`PF09726`	Macoilin	48	148	0.025	13.9
TkA02G482880	`PF24126`	DUF7394	67	99	9.6	7.3
TkA02G482880	`PF07716`	bZIP_2	69	115	0.00013	22.6
TkA02G482880	`PF13863`	DUF4200	70	127	0.025	15.6
TkA02G482880	`PF00170`	bZIP_1	71	129	1.8e-07	31.9
TkA02G482880	`PF03131`	bZIP_Maf	71	132	0.018	16.2
TkA02G482880	`PF30842`	LEKR1	75	150	1.0	10.4
TkA02G482880	`PF06785`	UPF0242	79	162	0.29	11.9
TkA02G482880	`PF06156`	YabA	96	143	0.86	10.9
TkA02G482880	`PF00170`	bZIP_1	123	146	1.8e-07	31.9
TkA02G482880	`PF24126`	DUF7394	124	148	9.6	7.3
TkA02G482880	`PF07716`	bZIP_2	125	141	0.00013	22.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LQ65`	Arabidopsis thaliana	sp\|Q9LQ65\|BZIP4_ARATH Basic leucine zipper 4	47.100%	Swiss-Prot	Low
`Q9FMC2`	Arabidopsis thaliana	sp\|Q9FMC2\|BZP43_ARATH Basic leucine zipper 43	38.500%	Swiss-Prot	Medium
`C0Z2L5`	Arabidopsis thaliana	sp\|C0Z2L5\|BZP44_ARATH bZIP transcription factor 44	40.200%	Swiss-Prot	Medium
`Q9LZP8`	Arabidopsis thaliana	sp\|Q9LZP8\|BZP53_ARATH bZIP transcription factor 53	43.600%	Swiss-Prot	Medium
`Q9SI15`	Arabidopsis thaliana	sp\|Q9SI15\|BZIP2_ARATH bZIP transcription factor 2	41.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card