TkA02G465460 | RubberDandelionOmics

Gene overview

TkA02G465460

Reference: TK1151 Chr: Chr02 Coordinates: 118621289-118625241 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

483 bp · TkA02G465460|TK1151|cDNA

ATTCCTCAACTGGACTTTGAGATTCCTCCAGAAGCTCAACGGGGATCTTTATCAACTGTGGAAGGGATACTACTAAGAGCTTCTGAAGAATTGCAAGCCCTTCAAGAAGAGAGAAAGAAAGTGGACCCCCAAACTGCTGAAGCAATAGACAAGTTCATATCAAAATTAAAAGAATGTGCAACTGGAAATTTCCCTTTCACCTTCATTCTTGATGATCCAGCTGGCAACAGTTTTGTAGAGAACCCGTTTGCACCATCTTC...

CDS

Download CDS FASTA

483 bp · TkA02G465460|TK1151|CDS

ATTCCTCAACTGGACTTTGAGATTCCTCCAGAAGCTCAACGGGGATCTTTATCAACTGTGGAAGGGATACTACTAAGAGCTTCTGAAGAATTGCAAGCCCTTCAAGAAGAGAGAAAGAAAGTGGACCCCCAAACTGCTGAAGCAATAGACAAGTTCATATCAAAATTAAAAGAATGTGCAACTGGAAATTTCCCTTTCACCTTCATTCTTGATGATCCAGCTGGCAACAGTTTTGTAGAGAACCCGTTTGCACCATCTTC...

Protein

Download Protein FASTA

160 aa · TkA02G465460|TK1151|PROTEIN

IPQLDFEIPPEAQRGSLSTVEGILLRASEELQALQEERKKVDPQTAEAIDKFISKLKECATGNFPFTFILDDPAGNSFVENPFAPSSDPSLRIELYDRSHEQQELLGYSFDPTQSTQELPNVEPHGSVGAVAGRRAIAQGSTAEFSESLFRYTAPEEVLY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G465460`
TK1151 ID	TkA02G465460
OH-1004 ID	LXL04_013908
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 99.375 / OH-1004 6.904 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G465460`
Location	Chr02:118621289-118625241 (-)
Description	Similar to GLR3.6: Glutamate receptor 3.6
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013908` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006816 calcium ion transport Biological Process GO:0006874 intracellular calcium ion homeostasis Biological Process GO:0007267 cell-cell signaling Biological Process GO:0009416 response to light stimulus Biological Process GO:0009611 response to wounding Biological Process GO:0009630 gravitropism Biological Process GO:0009864 induced systemic resistance, jasmonic acid mediated signaling pathway Biological Process GO:0019722 calcium-mediated signaling Biological Process GO:0045087 innate immune response Biological Process GO:0050832 defense response to fungus Biological Process GO:0071230 cellular response to amino acid stimulus Biological Process GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference	ath:AT1G42540 ath:AT3G51480 osa:124544569 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.439

Rank 1 · TkA02G465460 · TK1151

Nucleus0.435

Rank 2 · TkA02G465460 · TK1151

Plastid0.116

Rank 3 · TkA02G465460 · TK1151

Extracellular0.064

Rank 4 · TkA02G465460 · TK1151

Endoplasmic reticulum0.063

Rank 5 · TkA02G465460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22794jr-ZPR11-108 aa

PF10669Phage_Gp2327-58 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G465460	`PF22794`	jr-ZPR1	1	108	3.3e-37	127.9
TkA02G465460	`PF10669`	Phage_Gp23	27	58	0.29	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card