TkA02G464810 | RubberDandelionOmics

Gene overview

TkA02G464810

Reference: TK1151 Chr: Chr02 Coordinates: 118413433-118426725 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3563 bp · TkA02G464810|TK1151|cDNA

AACTATGAGTCTATACGCCGTAGGCTGGTCTATGTTTCTAGCTCACACAAATACCTTAACACGCAGTAGCCGCCGCCCCTCCACTCGACGAAGTTAGGTTAAATAAATCCATTTTCATTCTTTAGTTGACGATCCTATTCCACTGAAGAAGATTCGAAGGTCAATTCAACTCCACTACTCTTAATGTTGAAGCAAAATGGAAATGTCAACGGCAATGGTTCTAGAAGCTAGCCGACGGCGGCGGTTTCAGTTTGTTACGT...

CDS

Download CDS FASTA

513 bp · TkA02G464810|TK1151|CDS

ATGGAATCGGCTGGTAAATCAGTAGATGAAGTATTGGAAGAGATAATGAGAATTCATAGGTCTCTTCCTCCACGGCCGGGAATTGACGATGTTGAAGGTGCGAAAATTCTCATCCGAAACTTGGAGGCCGAAGAACAAGCAAAGTTCGAAGCCATAATTAGGCAAAAGAAGCGAAAAGACGTTCCTGAAGAACTATTCACCATTTTGGTAGAGATGAAGAAGAATTTACTCCGTTTCCAGAGCGAAGAACAAAAGAAGGA...

Protein

Download Protein FASTA

170 aa · TkA02G464810|TK1151|PROTEIN

MESAGKSVDEVLEEIMRIHRSLPPRPGIDDVEGAKILIRNLEAEEQAKFEAIIRQKKRKDVPEELFTILVEMKKNLLRFQSEEQKKEAIKLLDLENYHQVFDEMIQRASNCCGPSCKENSTQSVASTSKQFFLLLLRFKFYQRFTTHGDCIQNRFLPFTMTKSLSKRPSC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G464810`
TK1151 ID	TkA02G464810
OH-1004 ID	LXL04_024731
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	70.300
Protein coverage (%)	TK1151 75.294 / OH-1004 20.903 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G464810

Location Chr02:118413433-118426725 (+)

Description Similar to PIRL4: Plant intracellular Ras-group-related LRR protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35470`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release
`At2g17440`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0511700`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024731 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0055046 microgametogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G17440

ath:AT3G26500

ath:AT4G35470

dosa:Os08g0511700

dosa:Os10g0572300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.498

Rank 1 · TkA02G464810 · TK1151

Cytoplasm0.425

Rank 2 · TkA02G464810 · TK1151

Mitochondrion0.122

Rank 3 · TkA02G464810 · TK1151

Cell membrane0.067

Rank 4 · TkA02G464810 · TK1151

Endoplasmic reticulum0.047

Rank 5 · TkA02G464810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29468AIM36_C35-106 aa

PF05936T6SS_VasE48-107 aa

PF19788DUF627255-87 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G464810	`PF29468`	AIM36_C	35	106	0.033	15.2
TkA02G464810	`PF05936`	T6SS_VasE	48	107	0.096	12.2
TkA02G464810	`PF19788`	DUF6272	55	87	0.068	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SVW8`	Arabidopsis thaliana	sp\|Q9SVW8\|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4	56.900%	Swiss-Prot	High
`Q5G5E0`	Arabidopsis thaliana	sp\|Q5G5E0\|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5	59.800%	Swiss-Prot	Medium
`Q6Z8P4`	Oryza sativa subsp. japonica	sp\|Q6Z8P4\|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4	41.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card