LXL04_024731 | RubberDandelionOmics

Gene overview

LXL04_024731

Reference: OH-1004 Chr: Chr05 Coordinates: 97632143-97634028 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1797 bp · LXL04_024731|LXL04_024731|OH1004|cDNA

ATGGATTCATCTGCGAAATCAGTAGACGACGTGGTGGAAGAGATAATGAGAATTCATAGATCTCTTCCTCCAAGACCTGGAATCGATGATGTTGAAGCTGCATTGATACTAATCCGGAACGCAGACAATGAAGAACAATCAAGGATCGAAAGCATTTCCAGGCAAAAGAAGCGAAAATACATCCCTGAAGAACTCTTCAACGTCCTGTTAGAGATGCAGAAACAATCAGTCCAATTCCAAAGTAAAGAACAGAAGAGAGA...

CDS

Download CDS FASTA

1797 bp · LXL04_024731|LXL04_024731|OH1004|CDS

ATGGATTCATCTGCGAAATCAGTAGACGACGTGGTGGAAGAGATAATGAGAATTCATAGATCTCTTCCTCCAAGACCTGGAATCGATGATGTTGAAGCTGCATTGATACTAATCCGGAACGCAGACAATGAAGAACAATCAAGGATCGAAAGCATTTCCAGGCAAAAGAAGCGAAAATACATCCCTGAAGAACTCTTCAACGTCCTGTTAGAGATGCAGAAACAATCAGTCCAATTCCAAAGTAAAGAACAGAAGAGAGA...

Protein

Download Protein FASTA

598 aa · LXL04_024731|LXL04_024731|OH1004|PROTEIN

MDSSAKSVDDVVEEIMRIHRSLPPRPGIDDVEAALILIRNADNEEQSRIESISRQKKRKYIPEELFNVLLEMQKQSVQFQSKEQKREAVKLLDLENIHQLFDEMIQRASKCCSPSGNTQSGASTSSSSSPSTNTTSYSGTSFDLSTPTTASLTTSSTSSLSFDKDHVKSSHLFIKDDSYVNKSKFYSDSVGGGIGSSKFSRPQIVDSTLKPSITSGEFKSSHIYIILELDYLKILVSIALICHFVGQGGDKLSLIKLASL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024731`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024731

Location Chr05:97632143-97634028 (-)

Description Similar to PIRL4: Plant intracellular Ras-group-related LRR protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35470`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release
`At2g17440`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release
`At3g26500`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0511700`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release
`Os10g0572300`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024731 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0055046 microgametogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G17440

ath:AT3G26500

ath:AT4G35470

dosa:Os08g0511700

dosa:Os10g0572300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.304

Rank 1 · LXL04_024731 · OH-1004

Cytoplasm0.286

Rank 2 · LXL04_024731 · OH-1004

Nucleus0.267

Rank 3 · LXL04_024731 · OH-1004

Endoplasmic reticulum0.111

Rank 4 · LXL04_024731 · OH-1004

Lysosome / Vacuole0.088

Rank 5 · LXL04_024731 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_14281-347 aa

PF13855.13LRR_8286-328 aa

PF13855.13LRR_8294-351 aa

PF12799.14LRR_4294-332 aa

PF12799.14LRR_4317-355 aa

PF13855.13LRR_8340-397 aa

PF12799.14LRR_4340-378 aa

PF23598.2LRR_14359-473 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024731	`PF23598.2`	LRR_14	281	347	2.9e-35	122.4
LXL04_024731	`PF13855.13`	LRR_8	286	328	6.5e-35	119.4
LXL04_024731	`PF13855.13`	LRR_8	294	351	6.5e-35	119.4
LXL04_024731	`PF12799.14`	LRR_4	294	332	1.6e-25	89.2
LXL04_024731	`PF12799.14`	LRR_4	317	355	1.6e-25	89.2
LXL04_024731	`PF13855.13`	LRR_8	340	397	6.5e-35	119.4
LXL04_024731	`PF12799.14`	LRR_4	340	378	1.6e-25	89.2
LXL04_024731	`PF23598.2`	LRR_14	359	473	2.9e-35	122.4
LXL04_024731	`PF13855.13`	LRR_8	363	420	6.5e-35	119.4
LXL04_024731	`PF12799.14`	LRR_4	363	402	1.6e-25	89.2
LXL04_024731	`PF13855.13`	LRR_8	409	466	6.5e-35	119.4
LXL04_024731	`PF13855.13`	LRR_8	432	487	6.5e-35	119.4
LXL04_024731	`PF12799.14`	LRR_4	432	469	1.6e-25	89.2
LXL04_024731	`PF13855.13`	LRR_8	478	537	6.5e-35	119.4
LXL04_024731	`PF23598.2`	LRR_14	491	534	2.9e-35	122.4
LXL04_024731	`PF12799.14`	LRR_4	503	539	1.6e-25	89.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SVW8`	Arabidopsis thaliana	Plant intracellular Ras-group-related LRR protein 4	55.667%	Swiss-Prot	strong database homology
`Q5G5E0`	Arabidopsis thaliana	Plant intracellular Ras-group-related LRR protein 5	53.993%	Swiss-Prot	strong database homology
`Q9LRV8`	Arabidopsis thaliana	Plant intracellular Ras-group-related LRR protein 2	37.544%	Swiss-Prot	weak database homology
`Q6Z8P4`	Oryza sativa subsp. japonica	Plant intracellular Ras-group-related LRR protein 4	49.172%	Swiss-Prot	moderate database homology
`Q8S7M7`	Oryza sativa subsp. japonica	Plant intracellular Ras-group-related LRR protein 5	55.523%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card