RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G463170
Reference: TK1151 Chr: Chr02 Coordinates: 117994905-118002128 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

4471 bp · TkA02G463170|TK1151|cDNA

ACTTACTTTATTCTCCGTTGAAAAAATGTTACAATGACACTACATATTTTATTATAATAACATTATTAAATGTGAAAATACATATTAATGAAAAATTCTGAAATTTTATTTTCAAAACAGTCTCGTGACCCCAGCAATCCCTTTACCTCCCTCCTCTCTCTCTTTCTCTCTCTCATCACTGCCGGCAACAAACGACTGGTACAGATCTTCCTCTCTACGGCATCGATGCTATACCTATCTTCATCTCCACTCGTATTGTT...

CDS

Download CDS FASTA

3810 bp · TkA02G463170|TK1151|CDS

ATGGCTTCCGATGCACCATCAATAATGGCTCAAAGTGTGAGAACAAGCAGATCTTCATTCAGCTCAAGCAATGGATATGAAACTCAATCTCACTATTCCGCCATTACAAACGGAGATGACTATGACAGCGATGGTTCAAATTTTGCACCACCTACGCCAATGACCCTCTCCAATTCCATTCCAGCCGAGCTTGCTGGTGCAATTCCCCTAATCGACAAATTCCAAGTAGAGGGTTTTCTAAGGTCCATGCAAAAACAAAT...

Protein

Download Protein FASTA

1269 aa · TkA02G463170|TK1151|PROTEIN

MASDAPSIMAQSVRTSRSSFSSSNGYETQSHYSAITNGDDYDSDGSNFAPPTPMTLSNSIPAELAGAIPLIDKFQVEGFLRSMQKQINSAGKRGFFSKRSVGPQDREKFTFEDMLCFQKDPIPTSLLKINGDLVSRAVKLFQTILKYTGIDSTEKGNQIGIEDRIELVGKLFKQALKRSELRDELFAQISKQTRNCPDRQHLIRAWELMYLCASCMPPSKDIGGYLSEYIHDVAHNSNTDPDVQVYALNTLNALKCSVKA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G463170
TK1151 IDTkA02G463170
OH-1004 IDLXL04_013931
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.900
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G463170
LocationChr02:117994905-118002128 (+)
DescriptionSimilar to KIN14E: Kinesin-like protein KIN-14E
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g65930 Minus-end microtubule-dependent motor protein involved in the regulation of cell division and trichome morphogenesis through microtubules bundling.
Bundling of microtubules by motor and tail domains of a kinesin-like calmodulin-binding protein from Arabidopsis: regulation by Ca(2+)/Calmodulin.2000 · DOI: 10.1006/bbrc.1999.1896
KIC, a novel Ca2+ binding protein with one EF-hand motif, interacts with a microtubule motor protein and regulates trichome morphogenesis.2004 · DOI: 10.1105/tpc.016600
Analysis of calcium/calmodulin regulation of a plant kinesin using co-sedimentation and ATPase assays.2007 · DOI: 10.1007/978-1-59745-490-2_2
PERK-KIPK-KCBP signalling negatively regulates root growth in Arabidopsis thaliana.2015 · DOI: 10.1093/jxb/eru390
A novel plant calmodulin-binding protein with a kinesin heavy chain motor domain.1996 · DOI: 10.1074/jbc.271.12.7052
In vitro motility of AtKCBP, a calmodulin-binding kinesin protein of Arabidopsis.1997 · DOI: 10.1073/pnas.94.1.322
Interaction of Arabidopsis kinesin-like calmodulin-binding protein with tubulin subunits: modulation by Ca(2+)-calmodulin.1997 · DOI: 10.1046/j.1365-313x.1997.12051139.x
Characterization of microtubule binding domains in the Arabidopsis kinesin-like calmodulin binding protein.1998 · DOI: 10.1105/tpc.10.6.957
Ca2+/calmodulin regulation of the Arabidopsis kinesin-like calmodulin-binding protein.1998 · DOI: 10.1002/(sici)1097-0169(1998)40:4<408::aid-cm8>3.0.co;2-6
At5g27000 Microtubule-binding motor protein. No verified direct reference in this release
At2g22610 Kinesin-like protein KIN-14R. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os04g0666900 Minus-end microtubule-dependent motor protein involved in the regulation of cell division. No verified direct reference in this release
Os03g0114000 Kinesin-like protein KIN-14E. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_013931 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0001578 microtubule bundle formation Biological Process
GO:0007017 microtubule-based process Biological Process
GO:0007018 microtubule-based movement Biological Process
GO:0010091 trichome branching Biological Process
GO:0043622 cortical microtubule organization Biological Process
GO:0048629 trichome patterning Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005856 cytoskeleton Cellular Component
GO:0005871 kinesin complex Cellular Component
GO:0005874 microtubule Cellular Component
GO:0009524 phragmoplast Cellular Component
KEGG gene cross-reference
ath:AT2G47500
ath:AT5G27000
ath:AT5G65930
dosa:Os03g0114000
dosa:Os04g0666900
osa:4337322
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.651
Rank 1 · TkA02G463170 · TK1151
Cell membrane0.297
Rank 2 · TkA02G463170 · TK1151
Nucleus0.177
Rank 3 · TkA02G463170 · TK1151
Golgi apparatus0.089
Rank 4 · TkA02G463170 · TK1151
Lysosome / Vacuole0.042
Rank 5 · TkA02G463170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00784MyTH4170-274 aa
PF21989RA_2279-381 aa
PF16796Microtub_bd303-321 aa
PF00373FERM_M386-501 aa
PF02174IRS512-588 aa
PF24522KRIT1_FRMD8_FERM_C518-580 aa
PF08614ATG16625-717 aa
PF00784MyTH4638-663 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G463170PF00784MyTH41702747.7e-2897.6
TkA02G463170PF21989RA_22793811.3e-0629.1
TkA02G463170PF16796Microtub_bd3033211.7e-44152.2
TkA02G463170PF00373FERM_M3865011.6e-2177.5
TkA02G463170PF02174IRS5125883e-0731.1
TkA02G463170PF24522KRIT1_FRMD8_FERM_C5185804.8e-0524.4
TkA02G463170PF08614ATG166257179.97.0
TkA02G463170PF00784MyTH46386637.7e-2897.6
TkA02G463170PF16796Microtub_bd6396601.7e-44152.2
TkA02G463170PF21989RA_26426711.3e-0629.1
TkA02G463170PF00225Kinesin6496555.3e-109364.9
TkA02G463170PF08614ATG167247679.97.0
TkA02G463170PF21989RA_27347781.3e-0629.1
TkA02G463170PF00373FERM_M7708151.6e-2177.5
TkA02G463170PF08614ATG167878719.97.0
TkA02G463170PF16796Microtub_bd87410321.7e-44152.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FHN8Arabidopsis thalianasp|Q9FHN8|KN14E_ARATH Kinesin-like protein KIN-14E70.500%Swiss-ProtHigh
O81635Arabidopsis thalianasp|O81635|KN14G_ARATH Kinesin-like protein KIN-14G42.600%Swiss-ProtLow
F4IJK6Arabidopsis thalianasp|F4IJK6|KN14R_ARATH Kinesin-like protein KIN-14R40.900%Swiss-ProtLow
Q7XPJ0Oryza sativa subsp. japonicasp|Q7XPJ0|KN14I_ORYSJ Kinesin-like protein KIN-14I71.300%Swiss-ProtHigh
B9FAF3Oryza sativa subsp. japonicasp|B9FAF3|KN14E_ORYSJ Kinesin-like protein KIN-14E37.000%Swiss-ProtLow

JBrowse

View in Genome Browser