TkA02G450960 | RubberDandelionOmics

Gene overview

TkA02G450960

Reference: TK1151 Chr: Chr02 Coordinates: 114722018-114725760 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2717 bp · TkA02G450960|TK1151|cDNA

CCACAATACAATATTGACAAATCTATTCATGTTGACCGAGTGTAATAGAAAAAAAGGAGCAGAATTCAAGTCAACAAAAGTTGCCTTAAACAACAAGAAAAAAACCACTTCTGATTCCACAGCTTTTTTTCTACCTTTCCAACAATGGCTGACAGAGGTATACTGCTAATGTTCATCCTCACTATATCTTTTTACTCTTTCAGCAATCCTTGTTACTCACAAATCGATACCTTACTACAAGGTCAACGGCTCAAAGACTG...

CDS

Download CDS FASTA

2442 bp · TkA02G450960|TK1151|CDS

ATGGCTGACAGAGGTATACTGCTAATGTTCATCCTCACTATATCTTTTTACTCTTTCAGCAATCCTTGTTACTCACAAATCGATACCTTACTACAAGGTCAACGGCTCAAAGACTGGGATGAACTAATTTCACCAAACATGATCTTCACTTTGAAGTTCTTTAGCTTTGGCACCAGCATAAGCCCTTATTTAGGGATATTCTACAACCCCAACCGAAGAAGAGAAACTTCTAGTCGATATGATGATTTGTACGAATCAAA...

Protein

Download Protein FASTA

813 aa · TkA02G450960|TK1151|PROTEIN

MADRGILLMFILTISFYSFSNPCYSQIDTLLQGQRLKDWDELISPNMIFTLKFFSFGTSISPYLGIFYNPNRRRETSSRYDDLYESNKPVWVANRNNPITDIFGKLTIDAHGKLSILSGGGTVVDLFSPTPVLTRNASATLLDTGNFVLQEMYPDGSVNRILWQSFDYPTDTLLPGMKLGINLKTGHKWSLTSWRRKDLPADGSFTLTADSNRSGQMVILRRGNIHWMSGYWQNGGFRNTDLQNSGPDVRLYYVSNETEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G450960`
TK1151 ID	TkA02G450960
OH-1004 ID	LXL04_031667
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	68.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G450960

Location Chr02:114722018-114725760 (+)

Description Similar to At1g67520: G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16030`	Promotes the expression of genes involved in photosynthesis at least in dedifferentiated calli.	Arabidopsis mutants by activation tagging in which photosynthesis genes are expressed in dedifferentiated calli.2006 · DOI: 10.1093/pcp/pci242
`At1g67520`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520.	No verified direct reference in this release
`At4g21380`	Involved in the regulation of cellular expansion and differentiation.	No verified direct reference in this release
`At4g21390`	G-type lectin S-receptor-like serine/threonine-protein kinase B120.	No verified direct reference in this release
`At4g27290`	G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031667 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006955 immune response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009620 response to fungus Biological Process

GO:0045087 innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G61610

ath:AT1G65800

ath:AT1G67520

ath:AT3G16030

ath:AT4G21380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.863

Rank 1 · TkA02G450960 · TK1151

Endoplasmic reticulum0.078

Rank 2 · TkA02G450960 · TK1151

Cytoplasm0.071

Rank 3 · TkA02G450960 · TK1151

Nucleus0.038

Rank 4 · TkA02G450960 · TK1151

Lysosome / Vacuole0.028

Rank 5 · TkA02G450960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453B_lectin90-195 aa

PF01453B_lectin213-229 aa

PF14295PAN_4291-312 aa

PF00024PAN_1293-309 aa

PF14295PAN_4324-361 aa

PF00024PAN_1331-368 aa

PF08276PAN_2338-368 aa

PF08391Ly49421-482 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G450960	`PF01453`	B_lectin	90	195	1.5e-30	106.4
TkA02G450960	`PF01453`	B_lectin	213	229	1.5e-30	106.4
TkA02G450960	`PF14295`	PAN_4	291	312	0.019	15.8
TkA02G450960	`PF00024`	PAN_1	293	309	0.012	16.1
TkA02G450960	`PF14295`	PAN_4	324	361	0.019	15.8
TkA02G450960	`PF00024`	PAN_1	331	368	0.012	16.1
TkA02G450960	`PF08276`	PAN_2	338	368	0.00036	21.3
TkA02G450960	`PF08391`	Ly49	421	482	0.032	15.4
TkA02G450960	`PF00069`	Pkinase	497	713	4.9e-45	154.7
TkA02G450960	`PF07714`	PK_Tyr_Ser-Thr	498	766	1.1e-45	156.7
TkA02G450960	`PF03109`	ABC1	505	535	0.00037	20.4
TkA02G450960	`PF03109`	ABC1	607	644	0.00037	20.4
TkA02G450960	`PF11883`	DUF3403	769	813	1.1e-06	29.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LW83`	Arabidopsis thaliana	sp\|Q9LW83\|CE101_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase CES101	42.100%	Swiss-Prot	Medium
`O64793`	Arabidopsis thaliana	sp\|O64793\|Y1675_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520	42.800%	Swiss-Prot	Medium
`O81905`	Arabidopsis thaliana	sp\|O81905\|SD18_ARATH Receptor-like serine/threonine-protein kinase SD1-8	36.200%	Swiss-Prot	Medium
`O81906`	Arabidopsis thaliana	sp\|O81906\|B120_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase B120	36.700%	Swiss-Prot	Medium
`O81832`	Arabidopsis thaliana	sp\|O81832\|Y4729_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290	36.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card