TkA02G449570 | RubberDandelionOmics

Gene overview

TkA02G449570

Reference: TK1151 Chr: Chr02 Coordinates: 114358844-114361340 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1521 bp · TkA02G449570|TK1151|cDNA

ATAAAATTGGTTTTGATACGAGTATTCTGTAATCGTGATTTGTGGAGGGAAATACAGAATTCCGCAAAGAAGAGGAAATGGAAGAGAAAGATAACCAGAATCAAAACAACAGTTCATCATCATCGTTCGTGATCAAGATACCCTCATACGAAGAAGTTATTCAGAGCTCCCAATCGAAAACTCCTCCCCAGTCGCTTTTCAATCCTTCGTCTTTCTCTCAAGCCTTTAACTCCATTAAGAACACCGAGTTCTACGCTCCA...

CDS

Download CDS FASTA

1125 bp · TkA02G449570|TK1151|CDS

ATGGAAGAGAAAGATAACCAGAATCAAAACAACAGTTCATCATCATCGTTCGTGATCAAGATACCCTCATACGAAGAAGTTATTCAGAGCTCCCAATCGAAAACTCCTCCCCAGTCGCTTTTCAATCCTTCGTCTTTCTCTCAAGCCTTTAACTCCATTAAGAACACCGAGTTCTACGCTCCACCTCCACCTCCACCTCCTTCCTCCTCTTCACTTCCAAGGGGAATTCAGCCATCTGGGGTTGATGCTACTCCATCTTC...

Protein

Download Protein FASTA

374 aa · TkA02G449570|TK1151|PROTEIN

MEEKDNQNQNNSSSSSFVIKIPSYEEVIQSSQSKTPPQSLFNPSSFSQAFNSIKNTEFYAPPPPPPPSSSSLPRGIQPSGVDATPSSSSPPVSTANSTGASSSSAQNRNNAILVSHRQKGNPLLKHIRNVRWAFADVVCDYMLGQQSCALYLRYHLLHPDYLYFRIRELGKNFKLRVVLCHIDVEDVVKPLLEVTRTALLHDCTLLCGWSLEECGRYLETIKVYENKPADIIQGQMDTDYLSRVYMLNFLSLFQLSHALT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G449570`
TK1151 ID	TkA02G449570
OH-1004 ID	LXL04_014159
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G449570

Location Chr02:114358844-114361340 (-)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05210`	Seems to be involved in nucleotide excision repair (NER) of damaged DNA (dark repair mechanism).	Arabidopsis mutants sensitive to gamma radiation include the homologue of the human repair gene ERCC1.2003 · DOI: 10.1093/jxb/erg069 Roles of the AtErcc1 protein in recombination.2004 · DOI: 10.1111/j.1365-313x.2004.02136.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014159 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000720 pyrimidine dimer repair by nucleotide-excision repair Biological Process

GO:0000723 telomere maintenance Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006281 DNA repair Biological Process

GO:0006289 nucleotide-excision repair Biological Process

GO:0006294 nucleotide-excision repair, preincision complex assembly Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006312 mitotic recombination Biological Process

GO:0006949 syncytium formation Biological Process

GO:0006974 DNA damage response Biological Process

KEGG gene cross-reference

ath:AT3G05210

bta:615637

hsa:2067

mmu:13870

spo:2540887

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.902

Rank 1 · TkA02G449570 · TK1151

Cytoplasm0.219

Rank 2 · TkA02G449570 · TK1151

Mitochondrion0.031

Rank 3 · TkA02G449570 · TK1151

Cell membrane0.021

Rank 4 · TkA02G449570 · TK1151

Endoplasmic reticulum0.013

Rank 5 · TkA02G449570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15105TMEM6111-87 aa

PF03834Rad10110-228 aa

PF14520HHH_5258-309 aa

PF12826HHH_2261-315 aa

PF00633HHH280-301 aa

PF00570HRDC280-310 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G449570	`PF15105`	TMEM61	11	87	0.053	14.0
TkA02G449570	`PF03834`	Rad10	110	228	2.2e-45	154.0
TkA02G449570	`PF14520`	HHH_5	258	309	2.7e-07	31.7
TkA02G449570	`PF12826`	HHH_2	261	315	1.6e-05	25.7
TkA02G449570	`PF00633`	HHH	280	301	0.0039	17.7
TkA02G449570	`PF00570`	HRDC	280	310	0.022	15.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MA98`	Arabidopsis thaliana	sp\|Q9MA98\|ERCC1_ARATH DNA excision repair protein ERCC-1	65.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card