TkA02G443000 | RubberDandelionOmics

Gene overview

TkA02G443000

Reference: TK1151 Chr: Chr02 Coordinates: 112642968-112644227 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

814 bp · TkA02G443000|TK1151|cDNA

ATTGTAGAGAAAATTGGATAGTTTTATATTAGATTTACAATAATAAATTGGAAAAGATAATTTTTTTGCCAAATTTCATCTGTAAACCCTTTTTTTCCGTAACCCCTTTTTCTTCGTCGACCTCAAGTCTGCGATAAAATCTAGGTATTTTTGATTTCGCGGTGGCAATGTCGACAAGCGGATGGTTCAGGCCCACAATCGGAAGAACATCACCTCCAATTCCAAATCGTTCGCTCAATCTCAAATCCTCAAACCTACGT...

CDS

Download CDS FASTA

444 bp · TkA02G443000|TK1151|CDS

ATGTCGACAAGCGGATGGTTCAGGCCCACAATCGGAAGAACATCACCTCCAATTCCAAATCGTTCGCTCAATCTCAAATCCTCAAACCTACGTGCTTGTTTCATCGAATACCCTCTAGCTAGCAAGATCATCGTCAGAAATTTGTCGTACTCCACGAGTGAAAGCTGTTTAAAGGAAGAGTTTTCTAATTTCGGGAAAATAGCTGAAGTTAAGCTTGTTAAAGATGAAAACACAAAGAAATCAAAAGGGTATGCGTTTGT...

Protein

Download Protein FASTA

147 aa · TkA02G443000|TK1151|PROTEIN

MSTSGWFRPTIGRTSPPIPNRSLNLKSSNLRACFIEYPLASKIIVRNLSYSTSESCLKEEFSNFGKIAEVKLVKDENTKKSKGYAFVQYTNQDDAMSALETMDDKYLDGRVILVELAKPVRTRQSGYPKTSGPPQISPILGQMEMEH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G443000`
TK1151 ID	TkA02G443000
OH-1004 ID	LXL04_014268
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G443000

Location Chr02:112642968-112644227 (-)

Description Similar to S-RBP11: Small RNA-binding protein 11, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20930`	Involved in C-to-U editing of chloroplastic RNA.	An RNA recognition motif-containing protein is required for plastid RNA editing in Arabidopsis and maize.2013 · DOI: 10.1073/pnas.1220162110

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014268 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006858 extracellular transport Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009411 response to UV Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0016477 cell migration Biological Process

GO:0016554 cytidine to uridine editing Biological Process

GO:0030308 negative regulation of cell growth Biological Process

GO:0034063 stress granule assembly Biological Process

KEGG gene cross-reference

ath:AT1G73530

ath:AT3G23830

ath:AT5G06210

rno:81825

xla:379761

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.872

Rank 1 · TkA02G443000 · TK1151

Mitochondrion0.125

Rank 2 · TkA02G443000 · TK1151

Nucleus0.036

Rank 3 · TkA02G443000 · TK1151

Cytoplasm0.019

Rank 4 · TkA02G443000 · TK1151

Cell membrane0.008

Rank 5 · TkA02G443000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076RRM_129-37 aa

PF00076RRM_143-112 aa

PF28976RRM_ACIN143-104 aa

PF13893RRM_544-118 aa

PF08777RRM_350-104 aa

PF25015RBD_AKAP-17A51-104 aa

PF29326RRM_MUD2_C54-114 aa

PF05172RRM_Nup3554-112 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G443000	`PF00076`	RRM_1	29	37	3.4e-23	82.0
TkA02G443000	`PF00076`	RRM_1	43	112	3.4e-23	82.0
TkA02G443000	`PF28976`	RRM_ACIN1	43	104	0.18	12.6
TkA02G443000	`PF13893`	RRM_5	44	118	0.19	12.1
TkA02G443000	`PF08777`	RRM_3	50	104	0.22	12.3
TkA02G443000	`PF25015`	RBD_AKAP-17A	51	104	0.02	15.1
TkA02G443000	`PF29326`	RRM_MUD2_C	54	114	0.016	16.0
TkA02G443000	`PF05172`	RRM_Nup35	54	112	0.019	15.6
TkA02G443000	`PF20271`	CATASP	94	135	0.14	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L440`	Arabidopsis thaliana	sp\|Q8L440\|ORRM1_ARATH Organelle RRM domain-containing protein 1, chloroplastic	41.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card