TkA02G441250 | RubberDandelionOmics

Gene overview

TkA02G441250

Reference: TK1151 Chr: Chr02 Coordinates: 112165521-112167936 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1648 bp · TkA02G441250|TK1151|cDNA

TTAGTAGGGAAATTTCAGCTCAGTAGTGTCCAAATCCATCAATGGCGGAAGGTCAGCTTCAGCGAGGGAGAAGGCCCGGAAGGAGATCAGGGGGAGGAACAAACAGACACACCCTTCTTCCCCTCCGTCATGTTTCCCCTACCTCTCCAATTCCATTTCCTGCTGGTACTGTGACTTCAAGTCGTCTGTCTTCAATGAACCGCTATTCCAATTTGGACGGAAATACTTCAGGTGGTTGAGAATATGGTTTTCTATTGGGA...

CDS

Download CDS FASTA

1260 bp · TkA02G441250|TK1151|CDS

ATGGGTTTCAGCTTGACCACTTTAATTGGAGTTACAGTGATCATCTTAATGGAATCAGCTAAAGCTTTGAATCTGTTCAATGGGATCTCTTGGCTTAACAGTATTCTCAATGGATCTATCTTGGGATTCTACTCTTCAGTTTTCAAATACAGCATTTCAGTTGCTGACATTGGATACATGTGCATATCATCCATAATATCTGTATCCATACATGAACTTGGACATGCCCTTGCTGCCACAAGTGAGGGCATACAAATTGA...

Protein

Download Protein FASTA

419 aa · TkA02G441250|TK1151|PROTEIN

MGFSLTTLIGVTVIILMESAKALNLFNGISWLNSILNGSILGFYSSVFKYSISVADIGYMCISSIISVSIHELGHALAATSEGIQIEYTAVFLAVLFPGALVAFNDELLQMIPRVATLRIYCAGIWHNAALCVVCALTLFLLPFIFYPFCSHGESLMVLDVSNNSPLHGYLSPGDIITMLDGTHIHTTKQWIYISHHLNNQTPQTNKGYCVPNILIAGSKNPDKFTCPNHLTLLTTIPCLNSTTPNQPHVYCFPAKGILG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G441250`
TK1151 ID	TkA02G441250
OH-1004 ID	LXL04_014292
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	95.000
Protein coverage (%)	TK1151 100.000 / OH-1004 72.727 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G441250

Location Chr02:112165521-112167936 (-)

Description Similar to S2P: Membrane-bound transcription factor site-2 protease homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g20310`	Metalloprotease that catalyzes the second step (site-2 cleavage) in the proteolytic activation of various factors, after site-1 cleavage.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014292 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006607 NLS-bearing protein import into nucleus Biological Process

GO:0007095 mitotic G2 DNA damage checkpoint signaling Biological Process

GO:0008203 cholesterol metabolic process Biological Process

GO:0009651 response to salt stress Biological Process

GO:0030968 endoplasmic reticulum unfolded protein response Biological Process

GO:0031293 membrane protein intracellular domain proteolysis Biological Process

GO:0034976 response to endoplasmic reticulum stress Biological Process

GO:0036500 ATF6-mediated unfolded protein response Biological Process

GO:0045540 regulation of cholesterol biosynthetic process Biological Process

GO:0045542 positive regulation of cholesterol biosynthetic process Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

KEGG gene cross-reference

ath:AT4G20310

bta:533134

cge:100689085

hsa:51360

mmu:270669

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.344

Rank 1 · TkA02G441250 · TK1151

Golgi apparatus0.269

Rank 2 · TkA02G441250 · TK1151

Lysosome / Vacuole0.194

Rank 3 · TkA02G441250 · TK1151

Cytoplasm0.136

Rank 4 · TkA02G441250 · TK1151

Nucleus0.110

Rank 5 · TkA02G441250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02163Peptidase_M5064-380 aa

PF13180PDZ_2154-190 aa

PF17820PDZ_6160-192 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G441250	`PF02163`	Peptidase_M50	64	380	1.8e-17	64.2
TkA02G441250	`PF13180`	PDZ_2	154	190	0.00046	21.1
TkA02G441250	`PF17820`	PDZ_6	160	192	0.023	15.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JUU5`	Arabidopsis thaliana	sp\|F4JUU5\|S2P_ARATH Membrane-bound transcription factor site-2 protease homolog	42.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card