TkA02G440930 | RubberDandelionOmics

Gene overview

TkA02G440930

Reference: TK1151 Chr: Chr02 Coordinates: 112072398-112073620 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1155 bp · TkA02G440930|TK1151|cDNA

ATGAACAATTCAGAAAACTCAACATTTCCAAAGAGGGCTGAATTCCGTCTTCCGGAACATCAACAAATCAACCAAAGTATTTTCACTTCCAACAAATCTACACTTGATGGTAAGGCTTTCAAATTACTTCTAACCATCAACTACATATGTCTTTTTGTGGGGTCAGTGGCTTCTTCAATGCTCTTGAAATTCTACTTTAACCACAAAGGATCCAGCCGATGGGTATCCACTTGGGTCCAATCGGCCGGATTCCCCCTTCT...

CDS

Download CDS FASTA

1155 bp · TkA02G440930|TK1151|CDS

ATGAACAATTCAGAAAACTCAACATTTCCAAAGAGGGCTGAATTCCGTCTTCCGGAACATCAACAAATCAACCAAAGTATTTTCACTTCCAACAAATCTACACTTGATGGTAAGGCTTTCAAATTACTTCTAACCATCAACTACATATGTCTTTTTGTGGGGTCAGTGGCTTCTTCAATGCTCTTGAAATTCTACTTTAACCACAAAGGATCCAGCCGATGGGTATCCACTTGGGTCCAATCGGCCGGATTCCCCCTTCT...

Protein

Download Protein FASTA

384 aa · TkA02G440930|TK1151|PROTEIN

MNNSENSTFPKRAEFRLPEHQQINQSIFTSNKSTLDGKAFKLLLTINYICLFVGSVASSMLLKFYFNHKGSSRWVSTWVQSAGFPLLLLPIYLPYHLHCFKHKDGFDTKLLGLSFGIGLLLVISNICFSWGNSYLPLSTSSLVLSSQLAFTLLLSIIIVKQKITFLNLNCVVLLTLSCLLLALSSNGDRPEGLTRAKYFVGFFSTVCAGLLFALYLPVMEKIYSNVDCYAMVMEMQFVMEATATAVATLAMALAGGFKEM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G440930`
TK1151 ID	TkA02G440930
OH-1004 ID	LXL04_014302
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G440930

Location Chr02:112072398-112073620 (+)

Description Similar to PUP4: Probable purine permease 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g30840`	Probable purine permease 4.	No verified direct reference in this release
`At1g28230`	Proton-coupled purine transporter mediating adenine and trans-zeatin uptake.	Transport of cytokinins mediated by purine transporters of the PUP family expressed in phloem, hydathodes, and pollen of Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.01700.x Recycling of pyridoxine (vitamin B6) by PUP1 in Arabidopsis.2013 · DOI: 10.1111/tpj.12195
`At1g28220`	May be involved in transport of purine derivatives during pollen germination and tube elongation.	Transport of cytokinins mediated by purine transporters of the PUP family expressed in phloem, hydathodes, and pollen of Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.01700.x
`At4g08700`	Probable purine permease 13.	No verified direct reference in this release
`At4g18195`	Probable purine permease 8.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014302 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006863 purine nucleobase transport Biological Process

GO:0010184 cytokinin transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0005345 purine nucleobase transmembrane transporter activity Molecular Function

GO:0015211 purine nucleoside transmembrane transporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G28220

ath:AT1G28230

ath:AT1G30840

ath:AT2G33750

ath:AT4G18220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.358

Rank 1 · TkA02G440930 · TK1151

Lysosome / Vacuole0.310

Rank 2 · TkA02G440930 · TK1151

Endoplasmic reticulum0.176

Rank 3 · TkA02G440930 · TK1151

Golgi apparatus0.112

Rank 4 · TkA02G440930 · TK1151

Cytoplasm0.090

Rank 5 · TkA02G440930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16913PUNUT43-355 aa

PF00892EamA65-182 aa

PF18303Saf_2TM100-128 aa

PF08449UAA132-349 aa

PF03419Peptidase_U4137-247 aa

PF18303Saf_2TM169-213 aa

PF20382DUF6677193-212 aa

PF20382DUF6677199-284 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G440930	`PF16913`	PUNUT	43	355	6.1e-93	312.3
TkA02G440930	`PF00892`	EamA	65	182	2.9e-05	25.1
TkA02G440930	`PF18303`	Saf_2TM	100	128	0.013	15.8
TkA02G440930	`PF08449`	UAA	132	349	0.42	10.4
TkA02G440930	`PF03419`	Peptidase_U4	137	247	4.6	7.1
TkA02G440930	`PF18303`	Saf_2TM	169	213	0.013	15.8
TkA02G440930	`PF20382`	DUF6677	193	212	0.81	10.8
TkA02G440930	`PF20382`	DUF6677	199	284	0.81	10.8
TkA02G440930	`PF00892`	EamA	201	342	2.9e-05	25.1
TkA02G440930	`PF03419`	Peptidase_U4	289	353	4.6	7.1
TkA02G440930	`PF18303`	Saf_2TM	293	369	0.013	15.8
TkA02G440930	`PF20382`	DUF6677	295	320	0.81	10.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SY29`	Arabidopsis thaliana	sp\|Q9SY29\|PUP4_ARATH Probable purine permease 4	62.900%	Swiss-Prot	High
`Q9FZ96`	Arabidopsis thaliana	sp\|Q9FZ96\|PUP1_ARATH Purine permease 1	34.300%	Swiss-Prot	Medium
`Q9FZ95`	Arabidopsis thaliana	sp\|Q9FZ95\|PUP3_ARATH Purine permease 3	33.900%	Swiss-Prot	Medium
`Q8RY83`	Arabidopsis thaliana	sp\|Q8RY83\|PUP13_ARATH Probable purine permease 13	31.900%	Swiss-Prot	Medium
`Q0WRB9`	Arabidopsis thaliana	sp\|Q0WRB9\|PUP8_ARATH Probable purine permease 8	28.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card