LXL04_014302 | RubberDandelionOmics

Gene overview

LXL04_014302

Reference: OH-1004 Chr: Chr03 Coordinates: 45608933-45610153 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1221 bp · LXL04_014302|LXL04_014302|OH1004|cDNA

ATGAACAATTCAGAAAACTCAACATTTCCAAAGAGGGCTGAATTCCGTCTTCCGGAACATCAACAAATCAACCAAAGTATTTTCACTTCCAACAAATCTACACTTGATGGTAAGGCTTTCAAATTACTTCTAACCATCAACTACATATGTCTTTTTGTGGGGTCAGTGGCTTCTTCAATGCTCTTGAAATTCTACTTTAACCACAAAGGATCCAGCCGATGGGTATCCACTTGGGTCCAATCGGCCGGATTCCCCCTTCT...

CDS

Download CDS FASTA

1221 bp · LXL04_014302|LXL04_014302|OH1004|CDS

ATGAACAATTCAGAAAACTCAACATTTCCAAAGAGGGCTGAATTCCGTCTTCCGGAACATCAACAAATCAACCAAAGTATTTTCACTTCCAACAAATCTACACTTGATGGTAAGGCTTTCAAATTACTTCTAACCATCAACTACATATGTCTTTTTGTGGGGTCAGTGGCTTCTTCAATGCTCTTGAAATTCTACTTTAACCACAAAGGATCCAGCCGATGGGTATCCACTTGGGTCCAATCGGCCGGATTCCCCCTTCT...

Protein

Download Protein FASTA

406 aa · LXL04_014302|LXL04_014302|OH1004|PROTEIN

MNNSENSTFPKRAEFRLPEHQQINQSIFTSNKSTLDGKAFKLLLTINYICLFVGSVASSMLLKFYFNHKGSSRWVSTWVQSAGFPLLLLPIYLPYHLHCFKHKDGQQIVNRRKPFSSFDTKLLGLSFGIGLLLVISNICFSWGNSYLPLSTSSLVLSSQLAFTLLLSIIIVKQKITFLNLNCVVLLTLSCLLLALSSNGDRPEGLTRAKYFVGFFSTVCAGLLFALYLPVMEKIYSKVDCYAMVMEMQFVMEATATAVAT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014302`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014302

Location Chr03:45608933-45610153 (-)

Description Similar to PUP4: Probable purine permease 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g30840`	Probable purine permease 4.	No verified direct reference in this release
`At1g28220`	May be involved in transport of purine derivatives during pollen germination and tube elongation.	Transport of cytokinins mediated by purine transporters of the PUP family expressed in phloem, hydathodes, and pollen of Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.01700.x
`At1g28230`	Proton-coupled purine transporter mediating adenine and trans-zeatin uptake.	Transport of cytokinins mediated by purine transporters of the PUP family expressed in phloem, hydathodes, and pollen of Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.01700.x Recycling of pyridoxine (vitamin B6) by PUP1 in Arabidopsis.2013 · DOI: 10.1111/tpj.12195
`At2g33750`	Mediates adenine transport.	Transport of cytokinins mediated by purine transporters of the PUP family expressed in phloem, hydathodes, and pollen of Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.01700.x
`At4g18220`	Purine permease 21.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014302 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006863 purine nucleobase transport Biological Process

GO:0010184 cytokinin transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0005345 purine nucleobase transmembrane transporter activity Molecular Function

GO:0015211 purine nucleoside transmembrane transporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G28220

ath:AT1G28230

ath:AT1G30840

ath:AT2G33750

ath:AT4G18220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.410

Rank 1 · LXL04_014302 · OH-1004

Lysosome / Vacuole0.269

Rank 2 · LXL04_014302 · OH-1004

Endoplasmic reticulum0.174

Rank 3 · LXL04_014302 · OH-1004

Golgi apparatus0.105

Rank 4 · LXL04_014302 · OH-1004

Cytoplasm0.089

Rank 5 · LXL04_014302 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16913.12PUNUT43-367 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014302	`PF16913.12`	PUNUT	43	367	3.1e-95	319.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SY29`	Arabidopsis thaliana	Probable purine permease 4	61.875%	Swiss-Prot	strong database homology
`Q9FZ95`	Arabidopsis thaliana	Purine permease 3	32.849%	Swiss-Prot	moderate database homology
`Q9FZ96`	Arabidopsis thaliana	Purine permease 1	34.278%	Swiss-Prot	moderate database homology
`Q94GB1`	Arabidopsis thaliana	Purine permease 2	31.728%	Swiss-Prot	moderate database homology
`O49726`	Arabidopsis thaliana	Purine permease 21	29.397%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card