RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G439190
Reference: TK1151 Chr: Chr02 Coordinates: 111587127-111587609 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

483 bp · TkA02G439190|TK1151|cDNA

ATGATTTCTACAAAAGCAAATTTCTCTACATATATCGAATGCATATTCATTGTTCTTTGTTTCATTCAAGATAGTGTTTTATCAATATTTTACTTCGTCGGTATCTCTAAACCGGTCGGGCTCCACCATAACCACCATCACCAAAAAAAACCAGACAACTCTCCTATATCGGAGGTTTTGACTCGAGAGTTCCTCATGACCAGTAAATTCAAGAACATTCTAGGAAATGATTCATCGGAAGTTTGTTCAATATGTATTGA...

CDS

Download CDS FASTA

483 bp · TkA02G439190|TK1151|CDS

ATGATTTCTACAAAAGCAAATTTCTCTACATATATCGAATGCATATTCATTGTTCTTTGTTTCATTCAAGATAGTGTTTTATCAATATTTTACTTCGTCGGTATCTCTAAACCGGTCGGGCTCCACCATAACCACCATCACCAAAAAAAACCAGACAACTCTCCTATATCGGAGGTTTTGACTCGAGAGTTCCTCATGACCAGTAAATTCAAGAACATTCTAGGAAATGATTCATCGGAAGTTTGTTCAATATGTATTGA...

Protein

Download Protein FASTA

160 aa · TkA02G439190|TK1151|PROTEIN

MISTKANFSTYIECIFIVLCFIQDSVLSIFYFVGISKPVGLHHNHHHQKKPDNSPISEVLTREFLMTSKFKNILGNDSSEVCSICIDEFEGEDEIRCLTNCNHMFHKNCLDRWMDQIQDSCPLCRNPILPLACQEEYKKRFWAVTNLNNSYKQDYVNLGL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G439190
TK1151 IDTkA02G439190
OH-1004 IDLXL04_022621
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)72.100
Protein coverage (%)TK1151 96.250 / OH-1004 50.495
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G439190
LocationChr02:111587127-111587609 (-)
DescriptionSimilar to BRH1: Brassinosteroid-responsive RING protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g61460 May be involved in the brassinosteroids (BRs) signaling pathway and regulate the growth and development of rosette leaves.
Characterisation of BRH1, a brassinosteroid-responsive RING-H2 gene from Arabidopsis thaliana.2002 · DOI: 10.1007/s00425-001-0723-z
Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.2018 · DOI: 10.1007/s11427-017-9133-8
At2g47560 RING-H2 finger protein ATL64. No verified direct reference in this release
At2g46495 Putative RING-H2 finger protein ATL21A. No verified direct reference in this release
At2g04240 Function on abscisic acid homeostasis at post-translational level, probably through ubiquitin/proteasome-dependent substrate- specific degradation.
Upregulation of an Arabidopsis RING-H2 gene, XERICO, confers drought tolerance through increased abscisic acid biosynthesis.2006 · DOI: 10.1111/j.1365-313x.2006.02782.x
Global analysis of della direct targets in early gibberellin signaling in Arabidopsis.2007 · DOI: 10.1105/tpc.107.054999
At3g62690 RING-H2 finger protein ATL5. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_022621 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009741 response to brassinosteroid Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process
GO:0010200 response to chitin Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0047484 regulation of response to osmotic stress Biological Process
GO:0071456 cellular response to hypoxia Biological Process
GO:1901371 regulation of leaf morphogenesis Biological Process
GO:1905421 regulation of plant organ morphogenesis Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference
ath:AT1G23980
ath:AT2G01150
ath:AT2G35420
ath:AT3G18930
ath:AT3G61460
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.301
Rank 1 · TkA02G439190 · TK1151
Endoplasmic reticulum0.278
Rank 2 · TkA02G439190 · TK1151
Cytoplasm0.245
Rank 3 · TkA02G439190 · TK1151
Golgi apparatus0.171
Rank 4 · TkA02G439190 · TK1151
Cell membrane0.170
Rank 5 · TkA02G439190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13832zf-HC5HC2H_267-111 aa
PF08746zf-RING-like74-85 aa
PF14446Prok-RING_176-112 aa
PF14569zf-UDP77-126 aa
PF03107C1_277-109 aa
PF13920zf-C3HC4_379-128 aa
PF12678zf-rbx181-125 aa
PF23413zf_RING_Vps8_fungal81-86 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G439190PF13832zf-HC5HC2H_2671110.02515.5
TkA02G439190PF08746zf-RING-like74850.01216.4
TkA02G439190PF14446Prok-RING_1761120.003818.0
TkA02G439190PF14569zf-UDP771260.1113.3
TkA02G439190PF03107C1_2771090.4211.7
TkA02G439190PF13920zf-C3HC4_3791280.0001422.2
TkA02G439190PF12678zf-rbx1811251.7e-0835.3
TkA02G439190PF23413zf_RING_Vps8_fungal81860.01315.5
TkA02G439190PF23555zf-RING_Vps41811150.01415.7
TkA02G439190PF22908PHD_NSD811180.1313.3
TkA02G439190PF13639zf-RING_2821253e-1247.3
TkA02G439190PF17123zf-RING_11821102.3e-0937.5
TkA02G439190PF13923zf-C3HC4_2821245e-0833.3
TkA02G439190PF14634zf-RING_5821252.3e-0731.4
TkA02G439190PF00097zf-C3HC4821242.8e-0731.0
TkA02G439190PF13445zf-RING_UBOX821181.8e-0525.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9XF92Arabidopsis thalianasp|Q9XF92|BRH1_ARATH Brassinosteroid-responsive RING protein 142.900%Swiss-ProtMedium
O22255Arabidopsis thalianasp|O22255|ATL64_ARATH RING-H2 finger protein ATL6439.200%Swiss-ProtLow
P0CH01Arabidopsis thalianasp|P0CH01|AT21A_ARATH Putative RING-H2 finger protein ATL21A41.700%Swiss-ProtLow
Q9SI09Arabidopsis thalianasp|Q9SI09|XERIC_ARATH Probable E3 ubiquitin-protein ligase XERICO39.300%Swiss-ProtLow
Q9LZJ6Arabidopsis thalianasp|Q9LZJ6|ATL5_ARATH RING-H2 finger protein ATL551.000%Swiss-ProtLow

JBrowse

View in Genome Browser