TkA02G437680 | RubberDandelionOmics

Gene overview

TkA02G437680

Reference: TK1151 Chr: Chr02 Coordinates: 111221288-111221971 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

684 bp · TkA02G437680|TK1151|cDNA

ATGCCGAAGACATTCCCGATAGAACCCGGCCCATTCGCTACGTTCGAAGAATCAATCATTAATGGCGAACTTAATTTTAACGGAGAAGATACCGTTGTAGAAGACAGCTCTAAGAAAAACCCTCATACCCAACAAGAAACTCAAAGCCCAAACGTCTCTATCCCGACTAATACTTACCATCCCCCTAATATCCATTCCCCAACCCAAAATACCTCTAGCCCAAAGACTACTATACCAACCCAATTTACTTCCAGCCCAAT...

CDS

Download CDS FASTA

684 bp · TkA02G437680|TK1151|CDS

ATGCCGAAGACATTCCCGATAGAACCCGGCCCATTCGCTACGTTCGAAGAATCAATCATTAATGGCGAACTTAATTTTAACGGAGAAGATACCGTTGTAGAAGACAGCTCTAAGAAAAACCCTCATACCCAACAAGAAACTCAAAGCCCAAACGTCTCTATCCCGACTAATACTTACCATCCCCCTAATATCCATTCCCCAACCCAAAATACCTCTAGCCCAAAGACTACTATACCAACCCAATTTACTTCCAGCCCAAT...

Protein

Download Protein FASTA

227 aa · TkA02G437680|TK1151|PROTEIN

MPKTFPIEPGPFATFEESIINGELNFNGEDTVVEDSSKKNPHTQQETQSPNVSIPTNTYHPPNIHSPTQNTSSPKTTIPTQFTSSPIHAQEKPQKTINNPILMSDEIDPELYGILSPRLRELLSRGRMQNYDNHPKEKTTQKEQEGTEIGNASSRKKDQEKRKVSPRVTRSQSRIHSNSNSQLRIDVDGAESSMTAEIGKACGFNRGGDRVKETPRMGTKGAKNGQS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G437680`
TK1151 ID	TkA02G437680
OH-1004 ID	LXL04_022362
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	57.200
Protein coverage (%)	TK1151 62.115 / OH-1004 12.837 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G437680`
Location	Chr02:111221288-111221971 (-)
Description	Similar to Cytochrome P450 CYP72A219
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022362` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006694 steroid biosynthetic process Biological Process GO:0008203 cholesterol metabolic process Biological Process GO:0016135 saponin biosynthetic process Biological Process GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0016020 membrane Cellular Component GO:0004497 monooxygenase activity Molecular Function GO:0005506 iron ion binding Molecular Function GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function GO:0020037 heme binding Molecular Function
KEGG gene cross-reference	ath:AT3G14660 ath:AT3G14680 ath:AT3G14690 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.900

Rank 1 · TkA02G437680 · TK1151

Cytoplasm0.206

Rank 2 · TkA02G437680 · TK1151

Mitochondrion0.025

Rank 3 · TkA02G437680 · TK1151

Cell membrane0.024

Rank 4 · TkA02G437680 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA02G437680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16780AIMP2_LysRS_bd49-74 aa

PF16780AIMP2_LysRS_bd86-92 aa

PF20140DUF6530128-183 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G437680	`PF16780`	AIMP2_LysRS_bd	49	74	0.92	10.0
TkA02G437680	`PF16780`	AIMP2_LysRS_bd	86	92	0.92	10.0
TkA02G437680	`PF20140`	DUF6530	128	183	0.2	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card