TkA02G428760 | RubberDandelionOmics

Gene overview

TkA02G428760

Reference: TK1151 Chr: Chr02 Coordinates: 108913658-108915904 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1939 bp · TkA02G428760|TK1151|cDNA

TCTTTCGATAAAAATTCACATTAAATGAGAAAAACTTCGAACCCATACAACAAACAATGTATAAAACGAGACGAGAGAGATTTCTTAATGGAGATTGGACCATTGTTATTTCGGGTACTAAATACAACATTGAACTATATAATATACTATATAATAGTATCAAAATGAAAATTTTGTTTATCTTGATTCAAACTCCTTTGTGCTCTTATGAGAATATAGAAAACTCCGTGTCTCTACTCCCCAGACTCCAGTACTGCGAT...

CDS

Download CDS FASTA

1503 bp · TkA02G428760|TK1151|CDS

ATGAGAAAAACTTCGAACCCATACAACAAACAATGTATAAAACGAGACGAGAGAGATTTCTTAATGGAGATTGGACCATTGTTATTTCGGAAAACTCCGTGTCTCTACTCCCCAGACTCCAGTACTGCGATCGACGCCATTTGGTCAACGATGAGATTATCCCGTCAGCGATTCACCTTTCTCGTCTTCGCCGTTGTAATCTTACACTGTGCGTTTTTGTTCTCATCGCTCCGGGCGGCGGCGATGCCTTTGAAACCGGA...

Protein

Download Protein FASTA

500 aa · TkA02G428760|TK1151|PROTEIN

MRKTSNPYNKQCIKRDERDFLMEIGPLLFRKTPCLYSPDSSTAIDAIWSTMRLSRQRFTFLVFAVVILHCAFLFSSLRAAAMPLKPEVIGPLGQRLLEDAKSPEFFNWVTNIRRKIHEYPEFGFQEYKTSEVIRAELDKLGIEYTWPVAETGVVATIGSGEQPFFALRADMDALPIQELVDWDHRSKVAGKMHACGHDSHVAMLLGAAKLLQARRHELKGTVKLVFQPGEEGFAGAYHMLKHSALDNIIAAFALHVYPSY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G428760`
TK1151 ID	TkA02G428760
OH-1004 ID	LXL04_020952
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	52.700
Protein coverage (%)	TK1151 77.800 / OH-1004 87.727 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G428760

Location Chr02:108913658-108915904 (+)

Description Similar to ILL4: IAA-amino acid hydrolase ILR1-like 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02875`	Hydrolyzes certain amino acid conjugates of the plant growth regulator indole-3-acetic acid (IAA), including IAA-Phe, IAA-Leu and IAA-Tyr.	IAR3 encodes an auxin conjugate hydrolase from Arabidopsis.1999 · DOI: 10.1105/tpc.11.3.365 Characterization of a family of IAA-amino acid conjugate hydrolases from Arabidopsis.2002 · DOI: 10.1074/jbc.m111955200 ILR1, an amidohydrolase that releases active indole-3-acetic acid from conjugates.1995 · DOI: 10.1126/science.7792599

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0249700`	Hydrolyzes certain amino acid conjugates of the plant growth regulator indole-3-acetic acid (IAA).	No verified direct reference in this release
`Os03g0836800`	Hydrolyzes certain amino acid conjugates of the plant growth regulator indole-3-acetic acid (IAA).	No verified direct reference in this release
`Os07g0249800`	Hydrolyzes certain amino acid conjugates of the plant growth regulator indole-3-acetic acid (IAA).	No verified direct reference in this release
`Os03g0836900`	Hydrolyzes certain amino acid conjugates of the plant growth regulator indole-3-acetic acid (IAA).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020952 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0009850 auxin metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005788 endoplasmic reticulum lumen Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010178 IAA-amino acid conjugate hydrolase activity Molecular Function

GO:0010179 IAA-Ala conjugate hydrolase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G51760

ath:AT5G56650

ath:AT5G56660

dosa:Os01g0560000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.317

Rank 1 · TkA02G428760 · TK1151

Cytoplasm0.168

Rank 2 · TkA02G428760 · TK1151

Extracellular0.166

Rank 3 · TkA02G428760 · TK1151

Lysosome / Vacuole0.162

Rank 4 · TkA02G428760 · TK1151

Mitochondrion0.079

Rank 5 · TkA02G428760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01546Peptidase_M20166-480 aa

PF07687M20_dimer184-202 aa

PF04389Peptidase_M28199-254 aa

PF07687M20_dimer275-374 aa

PF04389Peptidase_M28423-460 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G428760	`PF01546`	Peptidase_M20	166	480	1.7e-42	146.4
TkA02G428760	`PF07687`	M20_dimer	184	202	9.8e-10	39.1
TkA02G428760	`PF04389`	Peptidase_M28	199	254	0.00044	20.8
TkA02G428760	`PF07687`	M20_dimer	275	374	9.8e-10	39.1
TkA02G428760	`PF04389`	Peptidase_M28	423	460	0.00044	20.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P54968`	Arabidopsis thaliana	sp\|P54968\|ILR1_ARATH IAA-amino acid hydrolase ILR1	65.700%	Swiss-Prot	High
`Q8H3C9`	Oryza sativa subsp. japonica	sp\|Q8H3C9\|ILL7_ORYSJ IAA-amino acid hydrolase ILR1-like 7	57.000%	Swiss-Prot	High
`Q851L5`	Oryza sativa subsp. japonica	sp\|Q851L5\|ILL3_ORYSJ IAA-amino acid hydrolase ILR1-like 3	57.100%	Swiss-Prot	High
`Q8H3C8`	Oryza sativa subsp. japonica	sp\|Q8H3C8\|ILL8_ORYSJ IAA-amino acid hydrolase ILR1-like 8	56.500%	Swiss-Prot	High
`Q851L6`	Oryza sativa subsp. japonica	sp\|Q851L6\|ILL4_ORYSJ IAA-amino acid hydrolase ILR1-like 4	57.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card