Gene Card
Gene overview
cDNA / CDS / Protein Sequences
381 bp · TkA02G422920|TK1151|cDNA
TTTACTCTATCTTCCGATGGAACTTGTAACGCTTCAAATATTTCAGAAAGTTTTGCAAGCCAGCAATTTACAGGAGCTGAAGATTGGGGTTTTGAGTCTGAGATTGGGGGAGGCAGTGTTGGTGTTGGAGGGACCATTGACCTTGATGGGCTTCCACCACCACCAACTGGTATGATATCATCATCGGCAAAGAATAAGCGAATGGATAATTATAAAGCAGGGCAGTGTCGTGATGCTATTAAATGGTTGTCTTGGGCTGT...
381 bp · TkA02G422920|TK1151|CDS
TTTACTCTATCTTCCGATGGAACTTGTAACGCTTCAAATATTTCAGAAAGTTTTGCAAGCCAGCAATTTACAGGAGCTGAAGATTGGGGTTTTGAGTCTGAGATTGGGGGAGGCAGTGTTGGTGTTGGAGGGACCATTGACCTTGATGGGCTTCCACCACCACCAACTGGTATGATATCATCATCGGCAAAGAATAAGCGAATGGATAATTATAAAGCAGGGCAGTGTCGTGATGCTATTAAATGGTTGTCTTGGGCTGT...
Protein
Download Protein FASTA126 aa · TkA02G422920|TK1151|PROTEIN
FTLSSDGTCNASNISESFASQQFTGAEDWGFESEIGGGSVGVGGTIDLDGLPPPPTGMISSSAKNKRMDNYKAGQCRDAIKWLSWAVILFEKNGDNFGIMEFFSSGASWYKEVGEYKKAGVDCSEL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G422920 |
|---|---|
| TK1151 ID | TkA02G422920 |
| OH-1004 ID | LXL04_029328 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 74.100 |
| Protein coverage (%) | TK1151 92.063 / OH-1004 22.874Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G422920 |
|---|---|
| Location | Chr02:107389140-107389520 (+) |
| Description | Similar to spag1a: Sperm-associated antigen 1A |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0007338 single fertilization Biological Process GO:0050821 protein stabilization Biological Process GO:0070286 axonemal dynein complex assembly Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005929 cilium Cellular Component GO:0097228 sperm principal piece Cellular Component GO:0101031 protein folding chaperone complex Cellular Component GO:0120293 dynein axonemal particle Cellular Component GO:0005525 GTP binding Molecular Function GO:0016787 hydrolase activity Molecular Function |
| KEGG gene cross-reference | hsa:6674 mmu:26942 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.