LXL04_029328 | RubberDandelionOmics

Gene overview

LXL04_029328

Reference: OH-1004 Chr: Chr06 Coordinates: 87638999-87640551 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1485 bp · LXL04_029328|LXL04_029328|OH1004|cDNA

ATGAATTCGAATTACGGAAGATCAACTCAATCGGGATCTCTCAACAACTTCGATTTCGATCTCGGAATCAATTCGAATCGTTCCAAACCTCTCAATGCTCAGAACAACAATACTTACACGCAATCTAAGCCTAACACGACGACGCCGGCTTGGCAACCCAACAAACCTTCCTGGACGCACCAACCCGCCGCTCCTACACAGCCGTCCTCTTTGGCCGGGGTATTAAATGGACCGACTTCAATGGTTGGAGACATCACGGG...

CDS

Download CDS FASTA

1485 bp · LXL04_029328|LXL04_029328|OH1004|CDS

ATGAATTCGAATTACGGAAGATCAACTCAATCGGGATCTCTCAACAACTTCGATTTCGATCTCGGAATCAATTCGAATCGTTCCAAACCTCTCAATGCTCAGAACAACAATACTTACACGCAATCTAAGCCTAACACGACGACGCCGGCTTGGCAACCCAACAAACCTTCCTGGACGCACCAACCCGCCGCTCCTACACAGCCGTCCTCTTTGGCCGGGGTATTAAATGGACCGACTTCAATGGTTGGAGACATCACGGG...

Protein

Download Protein FASTA

494 aa · LXL04_029328|LXL04_029328|OH1004|PROTEIN

MNSNYGRSTQSGSLNNFDFDLGINSNRSKPLNAQNNNTYTQSKPNTTTPAWQPNKPSWTHQPAAPTQPSSLAGVLNGPTSMVGDITGRSWASSAPQRPSSTSNIGIANKNPNLFSDLLGSNLGAGKANSTNVPLKNVAPASSQTAPKSAYSMGGMADSLPKSGNTVNSGGSWGSSQGYGNYNTTGYANKNQNLGGPSLKSSTVSGIGAGMSSNSNKDPFGSLVDFSSKPASGMKAGTKSTPPTKPTDDVFGSFQNASKPN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029328`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029328

Location Chr06:87638999-87640551 (-)

Description Similar to spag1a: Sperm-associated antigen 1A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g09420`	Chaperone receptor mediating Hsp90-dependent protein targeting to mitochondria.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029328 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007338 single fertilization Biological Process

GO:0050821 protein stabilization Biological Process

GO:0070286 axonemal dynein complex assembly Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005929 cilium Cellular Component

GO:0097228 sperm principal piece Cellular Component

GO:0101031 protein folding chaperone complex Cellular Component

GO:0120293 dynein axonemal particle Cellular Component

GO:0005525 GTP binding Molecular Function

GO:0016787 hydrolase activity Molecular Function

KEGG gene cross-reference

hsa:6674

mmu:26942

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.518

Rank 1 · LXL04_029328 · OH-1004

Golgi apparatus0.368

Rank 2 · LXL04_029328 · OH-1004

Endoplasmic reticulum0.168

Rank 3 · LXL04_029328 · OH-1004

Nucleus0.165

Rank 4 · LXL04_029328 · OH-1004

Cell membrane0.064

Rank 5 · LXL04_029328 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00515.35TPR_1414-445 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029328	`PF00515.35`	TPR_1	414	445	1.8e-10	40.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KCL7`	Arabidopsis thaliana	Outer envelope protein 64, mitochondrial	32.500%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card