TkA02G414200 | RubberDandelionOmics

Gene overview

TkA02G414200

Reference: TK1151 Chr: Chr02 Coordinates: 105315434-105326971 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3984 bp · TkA02G414200|TK1151|cDNA

GACGTATATTAAAATGTTTACATAATTAAACATGTGGTTCAAACTTCTAATAAACCGAGTATTGAATTGAACTTATCACTAAAAGTAATAATTAAATATCTAAAAGTTATAATACTCGATAAAATACGTCAATCATACAAAAGCATGGCTTGGTTTTTTTATGGAAGCAATCAAGCAATAGTTGGACTGCACATGGTGGTTGAAATCTGACCCAAATGACAAGATCCATATAGAATACGGGTTATACCCGGCAAAATGAC...

CDS

Download CDS FASTA

2823 bp · TkA02G414200|TK1151|CDS

ATGGTTAAAGGGAATATTTTCCATTACAGAAAGAACTCATGGCCTCCCGAAGAATACGTAAATCGGACTACTCTGCAACTGCTTGACTTCGACAGCGGAGCTCCTCCCGAACACGCATGGAGAAGAAAGCTAAACAGCCAAGCTGGTATCCTCAAGGAATTCAGCGTTACTTTCATGGAAGCAATGAAAATGATTGGTCTTGGAATACGTCTATGGTCGTATGTAAGGGAAGAGGCCTCTCATGGAAGGAGAGCACCTAT...

Protein

Download Protein FASTA

940 aa · TkA02G414200|TK1151|PROTEIN

MVKGNIFHYRKNSWPPEEYVNRTTLQLLDFDSGAPPEHAWRRKLNSQAGILKEFSVTFMEAMKMIGLGIRLWSYVREEASHGRRAPIDPFNREGKPSATQGVPLGGMGSGSITRGFRGEFRQFQIIPGACEPSPMMANQFSIFISRDAGNKKYASVLSPGQHDGTGTDSGLSSWGWNLNGQHSTYHALFPRAWTVYDGEPDPELKVSCRQISPFLPHNYRDSSLPVTVFVYTLVNTGKERAKVSLLFTWANSIGGTSHFT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G414200`
TK1151 ID	TkA02G414200
OH-1004 ID	LXL04_004060
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	79.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G414200`
Location	Chr02:105315434-105326971 (-)
Description	Similar to Gba2: Non-lysosomal glucosylceramidase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004060` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005975 carbohydrate metabolic process Biological Process GO:0006680 glucosylceramide catabolic process Biological Process GO:0008203 cholesterol metabolic process Biological Process GO:0008206 bile acid metabolic process Biological Process GO:0009247 glycolipid biosynthetic process Biological Process GO:0016139 glycoside catabolic process Biological Process GO:0030833 regulation of actin filament polymerization Biological Process GO:0031113 regulation of microtubule polymerization Biological Process GO:0046479 glycosphingolipid catabolic process Biological Process GO:0097035 regulation of membrane lipid distribution Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component
KEGG gene cross-reference	dme:Dmel_CG33090 hsa:57704 mmu:230101 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.286

Rank 1 · TkA02G414200 · TK1151

Cytoplasm0.279

Rank 2 · TkA02G414200 · TK1151

Endoplasmic reticulum0.192

Rank 3 · TkA02G414200 · TK1151

Nucleus0.185

Rank 4 · TkA02G414200 · TK1151

Golgi apparatus0.131

Rank 5 · TkA02G414200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12215Glyco_hydr_116N101-418 aa

PF17168DUF5127209-421 aa

PF04685GH116_catalytic526-883 aa

PF17389Bac_rhamnosid6H612-753 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G414200	`PF12215`	Glyco_hydr_116N	101	418	1.6e-108	363.7
TkA02G414200	`PF17168`	DUF5127	209	421	0.034	14.6
TkA02G414200	`PF04685`	GH116_catalytic	526	883	1.5e-161	538.3
TkA02G414200	`PF17389`	Bac_rhamnosid6H	612	753	0.00026	21.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card