TkA02G400510 | RubberDandelionOmics

Gene overview

TkA02G400510

Reference: TK1151 Chr: Chr02 Coordinates: 101727598-101729901 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1523 bp · TkA02G400510|TK1151|cDNA

TGTAGTACAGGGTCAAAGTATTGTACCGGTTTCACAATGTCGAGTTTAGAGGAACCTCTTGGTATAGACAAGTTGCCAAGCCTAAGCACCATTGATCATTTCCATAGATTTCATCCAACGGCTGCAGCACAAGTGGAGGGGACACTACAAGAGATATGCCTCAAACCCAAGGGAATAACAAGAACAATAACAAGTATCATTCACGACATTCTGCAAATTTTCAGCATAACTCGTACTCCAATGATGTAGGCATACAATAC...

CDS

Download CDS FASTA

936 bp · TkA02G400510|TK1151|CDS

ATGCCTCAAACCCAAGGGAATAACAAGAACAATAACAAGTATCATTCACGACATTCTGCAAATTTTCAGCATAACTCGTACTCCAATGATGTAGGCATACAATACATAACACATCAGATTTATAAAGGCATACCAAAGTACGTGAAGATAGTGGAAGTCGGCGCTAGGGATGGGCTACAAAATGAAAAGAATACGGTACCTACATCCGTAAAAATAGAATTAATTCAGAGGCTTGTTTCTACTGGATTATCAGTTGTAGA...

Protein

Download Protein FASTA

311 aa · TkA02G400510|TK1151|PROTEIN

MPQTQGNNKNNNKYHSRHSANFQHNSYSNDVGIQYITHQIYKGIPKYVKIVEVGARDGLQNEKNTVPTSVKIELIQRLVSTGLSVVEATSFVSPKWVPQLADATDVIGAVKGLDSARLPVLVPNLKGFEAAVTAGAKEIAVFASASESFSKSNINCSIEESLARYRDVVHAATNLCIPVRGYVSCVIGCPVDGITPPSKVAYIAKQLHDMGCCEISLGDTTGIGTPGTVISMLAAVMEFVPVEKLAVHFHDTYGQSLPNI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G400510`
TK1151 ID	TkA02G400510
OH-1004 ID	LXL04_000258
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	71.800
Protein coverage (%)	TK1151 84.244 / OH-1004 61.072 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G400510

Location Chr02:101727598-101729901 (+)

Description Similar to HMGCL: Hydroxymethylglutaryl-CoA lyase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26800`	Involved in the catabolism of branched amino acids such as leucine.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000258 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006552 L-leucine catabolic process Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006637 acyl-CoA metabolic process Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0007584 response to nutrient Biological Process

GO:0042594 response to starvation Biological Process

GO:0046951 ketone body biosynthetic process Biological Process

GO:0070542 response to fatty acid Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005777 peroxisome Cellular Component

KEGG gene cross-reference

ath:AT2G26800

bta:317658

mmu:15356

rno:79238

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.468

Rank 1 · TkA02G400510 · TK1151

Plastid0.261

Rank 2 · TkA02G400510 · TK1151

Nucleus0.190

Rank 3 · TkA02G400510 · TK1151

Mitochondrion0.158

Rank 4 · TkA02G400510 · TK1151

Peroxisome0.120

Rank 5 · TkA02G400510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00682HMGL-like48-297 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G400510	`PF00682`	HMGL-like	48	297	6.6e-48	164.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81027`	Arabidopsis thaliana	sp\|O81027\|HMGCL_ARATH Hydroxymethylglutaryl-CoA lyase, mitochondrial	73.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card