Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1290 bp · LXL04_000258|LXL04_000258|OH1004|cDNA
ATGCTATCATCTAAGGTTCTTGGTACTGTTACCAGGAGGAAACCTTTCCATCTCCACACATATACTCCTTCTACCTTTTTAAGCTCTTTAATGCTCATAGCCTCTAAAAACCATTTGACGACTGGTATGGATGCTCTTGAAAGCAACCATCCTGTAACATGTAAAACTCAACCATATAACAATCCAGCTGAAAACTACAGGAACTTAGGTCAACTTTTCTCCCCCAAAAGTCAAATACATCAATATCCACATACATCCAT...
1290 bp · LXL04_000258|LXL04_000258|OH1004|CDS
ATGCTATCATCTAAGGTTCTTGGTACTGTTACCAGGAGGAAACCTTTCCATCTCCACACATATACTCCTTCTACCTTTTTAAGCTCTTTAATGCTCATAGCCTCTAAAAACCATTTGACGACTGGTATGGATGCTCTTGAAAGCAACCATCCTGTAACATGTAAAACTCAACCATATAACAATCCAGCTGAAAACTACAGGAACTTAGGTCAACTTTTCTCCCCCAAAAGTCAAATACATCAATATCCACATACATCCAT...
Protein
Download Protein FASTA429 aa · LXL04_000258|LXL04_000258|OH1004|PROTEIN
MLSSKVLGTVTRRKPFHLHTYTPSTFLSSLMLIASKNHLTTGMDALESNHPVTCKTQPYNNPAENYRNLGQLFSPKSQIHQYPHTSMSNRYYSTQHTDNIPSISQHKLLGNIPRYVKIVEVGPRDGLQNEKDIVPTSIKIKLIKMLVDSGLQVVEATSFVSPKWVPQLADAKDVIEGIKGVNGVRFPVLTPNLKGLEAAIAAGVKEVAVFAAASESFSKSNINCSIDESLARYRDVASSARKLSIPVRGYISCVVGCPME...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_000258 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_000258 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:4829778-4832930 (+) | ||||||||||||
| Description | Similar to HMGCL: Hydroxymethylglutaryl-CoA lyase, mitochondrial | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006552 L-leucine catabolic process Biological Process GO:0006629 lipid metabolic process Biological Process GO:0006637 acyl-CoA metabolic process Biological Process GO:0007005 mitochondrion organization Biological Process GO:0007584 response to nutrient Biological Process GO:0042594 response to starvation Biological Process GO:0046951 ketone body biosynthetic process Biological Process GO:0070542 response to fatty acid Biological Process GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0005777 peroxisome Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT2G26800 bta:317658 mmu:15356 rno:79238 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00682.26HMGL-like116-388 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_000258 | PF00682.26 | HMGL-like | 116 | 388 | 1.9e-57 | 195.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.