TkA02G391250 | RubberDandelionOmics

Gene overview

TkA02G391250

Reference: TK1151 Chr: Chr02 Coordinates: 99396415-99405426 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

648 bp · TkA02G391250|TK1151|cDNA

CGTACACGCAATCAAAACCACTCTAGTTTCCTCTCAAACAAAACCGAAAAGGAAAAAAACCCGTTGATCAAGAAACTTAACACCCCCTTCACAATCCGACAACAAAACCACCATGGGATCAATTATCGAAAAAGCTCACAATTTGAAGATCTTGGGTTGTGGCACCCAGACAGTAGTCTTGGGCCACGGTTTCGGAACGGTTTCGGAACCGACCAGTCAGTTAATTTGGAGGCATCTAGTACCGCATCTTGTTGAAGATT...

CDS

Download CDS FASTA

390 bp · TkA02G391250|TK1151|CDS

ATGGGATCAATTATCGAAAAAGCTCACAATTTGAAGATCTTGGGTTGTGGCACCCAGACAGTAGTCTTGGGCCACGGTTTCGGAACGGTTTCGGAACCGACCAGTCAGTTAATTTGGAGGCATCTAGTACCGCATCTTGTTGAAGATTACAAGGTTGTTTTGTACGATAACATGGGGGCAGGTACCACTAACCCCGAGTACTTTGATTTCGATAGGTATGCAACTTTGGAAGGTTTTGCCCATGATATTATCGCTATTTT...

Protein

Download Protein FASTA

129 aa · TkA02G391250|TK1151|PROTEIN

MGSIIEKAHNLKILGCGTQTVVLGHGFGTVSEPTSQLIWRHLVPHLVEDYKVVLYDNMGAGTTNPEYFDFDRYATLEGFAHDIIAILEEVRVWSCIFVGHSISAMIGAVASIIRPDLFSKIIMLSASPR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G391250`
TK1151 ID	TkA02G391250
OH-1004 ID	LXL04_006731
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	77.800
Protein coverage (%)	TK1151 97.674 / OH-1004 23.633 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G391250

Location Chr02:99396415-99405426 (+)

Description Similar to D14L: Probable esterase D14L

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37470`	Involved in seed germination and seedling development.	Specialisation within the DWARF14 protein family confers distinct responses to karrikins and strigolactones in Arabidopsis.2012 · DOI: 10.1242/dev.074567 KAI2- and MAX2-mediated responses to karrikins and strigolactones are largely independent of HY5 in Arabidopsis seedlings.2013 · DOI: 10.1093/mp/sss127

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q10J20`	May be involved in strigolactone signaling pathway (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006731 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009640 photomorphogenesis Biological Process

GO:0009704 de-etiolation Biological Process

GO:0036377 arbuscular mycorrhizal association Biological Process

GO:0080167 response to karrikin Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016787 hydrolase activity Molecular Function

GO:0031386 protein tag activity Molecular Function

KEGG gene cross-reference

ath:AT4G37470

dosa:Os03g0437600

osa:4333199

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.721

Rank 1 · TkA02G391250 · TK1151

Nucleus0.375

Rank 2 · TkA02G391250 · TK1151

Peroxisome0.086

Rank 3 · TkA02G391250 · TK1151

Mitochondrion0.059

Rank 4 · TkA02G391250 · TK1151

Lysosome / Vacuole0.044

Rank 5 · TkA02G391250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12146Hydrolase_419-126 aa

PF00561Abhydrolase_120-126 aa

PF12697Abhydrolase_621-109 aa

PF04884UVB_sens_prot63-122 aa

PF03096Ndr64-128 aa

PF15880NDUFV364-73 aa

PF00137ATP-synt_C94-126 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G391250	`PF12146`	Hydrolase_4	19	126	6.7e-05	23.0
TkA02G391250	`PF00561`	Abhydrolase_1	20	126	3e-10	40.9
TkA02G391250	`PF12697`	Abhydrolase_6	21	109	3.9e-08	34.9
TkA02G391250	`PF04884`	UVB_sens_prot	63	122	0.068	13.5
TkA02G391250	`PF03096`	Ndr	64	128	0.011	15.3
TkA02G391250	`PF15880`	NDUFV3	64	73	0.31	11.7
TkA02G391250	`PF00137`	ATP-synt_C	94	126	0.099	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZU7`	Arabidopsis thaliana	sp\|Q9SZU7\|KAI2_ARATH Probable esterase KAI2	68.300%	Swiss-Prot	High
`Q10J20`	Oryza sativa subsp. japonica	sp\|Q10J20\|D14L_ORYSJ Probable esterase D14L	66.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card