Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1539 bp · LXL04_006731|LXL04_006731|OH1004|cDNA
ATGGGAGTTGTCGAACAAGCTCACAATGTTAAAATCCTAGGCTCCGGCAACCAGACAATCGTCTTGGCTCACGGTTTCGGAACGGACCAGTCGGTATGGAAGCATCTGGTGCCTCATCTCGTCGACGACTACAAGGTTGTACTGTACGATAACATGGGGGCAGGAACAACGAACCCAGAATACTTCGATTTCGATCGTTATGCCACTTTAGAAGGTTTCGCGTACGATGTTATTGGCATTTTGGAGGAACTACGTGTTTC...
1539 bp · LXL04_006731|LXL04_006731|OH1004|CDS
ATGGGAGTTGTCGAACAAGCTCACAATGTTAAAATCCTAGGCTCCGGCAACCAGACAATCGTCTTGGCTCACGGTTTCGGAACGGACCAGTCGGTATGGAAGCATCTGGTGCCTCATCTCGTCGACGACTACAAGGTTGTACTGTACGATAACATGGGGGCAGGAACAACGAACCCAGAATACTTCGATTTCGATCGTTATGCCACTTTAGAAGGTTTCGCGTACGATGTTATTGGCATTTTGGAGGAACTACGTGTTTC...
Protein
Download Protein FASTA512 aa · LXL04_006731|LXL04_006731|OH1004|PROTEIN
MGVVEQAHNVKILGSGNQTIVLAHGFGTDQSVWKHLVPHLVDDYKVVLYDNMGAGTTNPEYFDFDRYATLEGFAYDVIGILEELRVSSCIYVGHSVSAMIGAVASITRPDLFSKILMISASPRLFVNKSIMEDQRTTRPISSFLSSPRFFNGLFSPKTLQDSQSSPTLILDANKISVNNPFEINKNRIKPTKIFKEIKTPSEKFDHEGIALALVVEQPSETICKPNTISRKLLFTSNLKIQIPKLPTDYGIKTRSSQFFR...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_006731 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_006731 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:23540001-23545293 (+) | ||||||||||||
| Description | Similar to D14L: Probable esterase D14L | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0009640 photomorphogenesis Biological Process GO:0009704 de-etiolation Biological Process GO:0036377 arbuscular mycorrhizal association Biological Process GO:0080167 response to karrikin Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0016787 hydrolase activity Molecular Function GO:0031386 protein tag activity Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT4G37470 dosa:Os03g0437600 osa:4333199 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12146.16Hydrolase_418-130 aaPF00561.27Abhydrolase_119-120 aaPF12697.14Abhydrolase_620-150 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_006731 | PF12146.16 | Hydrolase_4 | 18 | 130 | 7.8e-07 | 29.4 |
| LXL04_006731 | PF00561.27 | Abhydrolase_1 | 19 | 120 | 3e-13 | 50.7 |
| LXL04_006731 | PF12697.14 | Abhydrolase_6 | 20 | 150 | 2.4e-11 | 45.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.