TkA02G384860 | RubberDandelionOmics

Gene overview

TkA02G384860

Reference: TK1151 Chr: Chr02 Coordinates: 97807908-97809236 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

618 bp · TkA02G384860|TK1151|cDNA

ATGGATTTTATGATGAATGCCTTCGGAAGTATGGAAATGCTAATGTTTGGAAACATTCACCGATCTTTTCGATTATTTCCCACTGACTGCATTGGTTATATGCAGATCCCAGAACTGTATGGCCAGTCAAATTCTCCTCAGTTGGAATGCATTGCATCCCTTGATTCACACAGTTCAAAGATTAAGTGTGTGCTATGGTGGCCATCTGGAAGACATGACAAGTTGATCAGTATTGATGAACAGAATATCTTTCTTTGGAG...

CDS

Download CDS FASTA

618 bp · TkA02G384860|TK1151|CDS

ATGGATTTTATGATGAATGCCTTCGGAAGTATGGAAATGCTAATGTTTGGAAACATTCACCGATCTTTTCGATTATTTCCCACTGACTGCATTGGTTATATGCAGATCCCAGAACTGTATGGCCAGTCAAATTCTCCTCAGTTGGAATGCATTGCATCCCTTGATTCACACAGTTCAAAGATTAAGTGTGTGCTATGGTGGCCATCTGGAAGACATGACAAGTTGATCAGTATTGATGAACAGAATATCTTTCTTTGGAG...

Protein

Download Protein FASTA

205 aa · TkA02G384860|TK1151|PROTEIN

MDFMMNAFGSMEMLMFGNIHRSFRLFPTDCIGYMQIPELYGQSNSPQLECIASLDSHSSKIKCVLWWPSGRHDKLISIDEQNIFLWSLDSSTSESSIQFWDLRIMKKTNSIECSHVRNIDYDSKKKHMLVTAADESGIHIWDVRMSKAPVAELPGHSHWTWAVRSNPEYEGIILSAGTDSPVIPLAATAFIISGDICRRYCYDFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G384860`
TK1151 ID	TkA02G384860
OH-1004 ID	LXL04_015184
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	80.100
Protein coverage (%)	TK1151 72.195 / OH-1004 52.312 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G384860

Location Chr02:97807908-97809236 (-)

Description Similar to DWA2: WD repeat-containing protein DWA2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76260`	Component of the CUL4-RBX1-DDB1-DWA1/DWA2 E3 ubiquitin- protein ligase complex that acts as a negative regulator in abscisic acid (ABA) signaling.	DWA1 and DWA2, two Arabidopsis DWD protein components of CUL4-based E3 ligases, act together as negative regulators in ABA signal transduction.2010 · DOI: 10.1105/tpc.109.073783

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015184 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0032456 endocytic recycling Biological Process

GO:0051049 regulation of transport Biological Process

GO:1905281 positive regulation of retrograde transport, endosome to Golgi Biological Process

GO:2001137 positive regulation of endocytic recycling Biological Process

GO:0000938 GARP complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G76260

gja:107122311

rno:362721

xtr:496745

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.453

Rank 1 · TkA02G384860 · TK1151

Nucleus0.447

Rank 2 · TkA02G384860 · TK1151

Lysosome / Vacuole0.078

Rank 3 · TkA02G384860 · TK1151

Golgi apparatus0.070

Rank 4 · TkA02G384860 · TK1151

Cell membrane0.069

Rank 5 · TkA02G384860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23609Beta-prop_EIPR135-92 aa

PF24797Beta-prop_WDR35_TULP_N41-90 aa

PF24105Beta-prop_CAF1B_HIR142-170 aa

PF25047Beta-prop_TEP1_2nd42-164 aa

PF23383Beta-prop_IFT140_1st44-91 aa

PF23381Beta-prop_IFT122_1st47-92 aa

PF25172Beta-prop_WDR3_2nd47-94 aa

PF25175Beta-prop_WDR549-90 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G384860	`PF23609`	Beta-prop_EIPR1	35	92	1.2e-41	143.8
TkA02G384860	`PF24797`	Beta-prop_WDR35_TULP_N	41	90	0.038	13.8
TkA02G384860	`PF24105`	Beta-prop_CAF1B_HIR1	42	170	0.00013	21.8
TkA02G384860	`PF25047`	Beta-prop_TEP1_2nd	42	164	0.0025	17.7
TkA02G384860	`PF23383`	Beta-prop_IFT140_1st	44	91	0.018	14.5
TkA02G384860	`PF23381`	Beta-prop_IFT122_1st	47	92	3.7e-07	30.5
TkA02G384860	`PF25172`	Beta-prop_WDR3_2nd	47	94	0.00088	19.3
TkA02G384860	`PF25175`	Beta-prop_WDR5	49	90	2.9e-08	34.1
TkA02G384860	`PF24814`	WD40_Prp19	49	89	3.3e-07	30.4
TkA02G384860	`PF25173`	Beta-prop_WDR3_1st	49	180	3.6e-07	30.8
TkA02G384860	`PF24782`	WD40_MABP1-WDR62_2nd	49	78	4.9e-05	23.2
TkA02G384860	`PF00400`	WD40	49	86	6.9e-05	23.9
TkA02G384860	`PF25174`	Beta-prop_THOC3	50	90	4.7e-08	33.1
TkA02G384860	`PF23775`	Beta-prop_RIG_2nd	50	94	0.00031	21.0
TkA02G384860	`PF23414`	Beta-prop_EML_2	53	87	0.022	14.9
TkA02G384860	`PF29037`	DSE1_N	58	93	0.00041	20.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NPN9`	Arabidopsis thaliana	sp\|Q6NPN9\|DWA2_ARATH WD repeat-containing protein DWA2	56.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card