LXL04_015184 | RubberDandelionOmics

Gene overview

LXL04_015184

Reference: OH-1004 Chr: Chr03 Coordinates: 65435387-65438018 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1041 bp · LXL04_015184|LXL04_015184|OH1004|cDNA

ATGCAAGGAGGATCAACTGGAATCGGTTACGGTCTCAAATATCAGGCAAGATGTATTGCGGATGTGAAAGCCGATACAGATCACACCAGTTTCCTCGCTGGTACTCTCAGTCTCAAAGAAGAAAATGAGGTGCATCTGATTAGGCTTTCATCAGGTGGTACGGAACTTGTTTGCGAGGGTTTGTTTTCCCATCCGAACGAGATATGGGACCTTGCTTCATGCCCTTTCGATCAACGAATATTCTCCACCGTCTTCTCTTC...

CDS

Download CDS FASTA

1041 bp · LXL04_015184|LXL04_015184|OH1004|CDS

ATGCAAGGAGGATCAACTGGAATCGGTTACGGTCTCAAATATCAGGCAAGATGTATTGCGGATGTGAAAGCCGATACAGATCACACCAGTTTCCTCGCTGGTACTCTCAGTCTCAAAGAAGAAAATGAGGTGCATCTGATTAGGCTTTCATCAGGTGGTACGGAACTTGTTTGCGAGGGTTTGTTTTCCCATCCGAACGAGATATGGGACCTTGCTTCATGCCCTTTCGATCAACGAATATTCTCCACCGTCTTCTCTTC...

Protein

Download Protein FASTA

346 aa · LXL04_015184|LXL04_015184|OH1004|PROTEIN

MQGGSTGIGYGLKYQARCIADVKADTDHTSFLAGTLSLKEENEVHLIRLSSGGTELVCEGLFSHPNEIWDLASCPFDQRIFSTVFSSGESYEAAVWQIPELYGQSNSPQLECIASLDAHSSKIKCVLWWPSGRHDKLISIDEQNIFLWSLDSSKKSAQVQSQESGGMLHHMTGGAWDPHDQNVVASTSESSIQFWDLRTMKKTNSIECSHVRNIDYDSKKKHMLVTAADESGIHIWDVRMSKAPVAELPGHSHWTWAVRS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015184`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015184

Location Chr03:65435387-65438018 (-)

Description Similar to DWA2: WD repeat-containing protein DWA2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76260`	Component of the CUL4-RBX1-DDB1-DWA1/DWA2 E3 ubiquitin- protein ligase complex that acts as a negative regulator in abscisic acid (ABA) signaling.	DWA1 and DWA2, two Arabidopsis DWD protein components of CUL4-based E3 ligases, act together as negative regulators in ABA signal transduction.2010 · DOI: 10.1105/tpc.109.073783

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015184 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0032456 endocytic recycling Biological Process

GO:0051049 regulation of transport Biological Process

GO:1905281 positive regulation of retrograde transport, endosome to Golgi Biological Process

GO:2001137 positive regulation of endocytic recycling Biological Process

GO:0000938 GARP complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G76260

gja:107122311

rno:362721

xtr:496745

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.560

Rank 1 · LXL04_015184 · OH-1004

Nucleus0.398

Rank 2 · LXL04_015184 · OH-1004

Lysosome / Vacuole0.119

Rank 3 · LXL04_015184 · OH-1004

Golgi apparatus0.102

Rank 4 · LXL04_015184 · OH-1004

Cell membrane0.080

Rank 5 · LXL04_015184 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23609.2Beta-prop_EIPR15-280 aa

PF24105.2Beta-prop_CAF1B_HIR180-161 aa

PF24814.2WD40_Prp1982-242 aa

PF25047.1Beta-prop_TEP1_2nd85-204 aa

PF25175.2Beta-prop_WDR5108-208 aa

PF25174.2Beta-prop_THOC3109-280 aa

PF24782.3WD40_MABP1-WDR62_2nd111-280 aa

PF23409.2Beta-prop_EML112-200 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015184	`PF23609.2`	Beta-prop_EIPR1	5	280	5.6e-100	335.1
LXL04_015184	`PF24105.2`	Beta-prop_CAF1B_HIR1	80	161	6.9e-12	45.7
LXL04_015184	`PF24814.2`	WD40_Prp19	82	242	1.2e-13	51.5
LXL04_015184	`PF25047.1`	Beta-prop_TEP1_2nd	85	204	2e-09	37.7
LXL04_015184	`PF25175.2`	Beta-prop_WDR5	108	208	2.4e-13	50.8
LXL04_015184	`PF25174.2`	Beta-prop_THOC3	109	280	5.5e-20	72.2
LXL04_015184	`PF24782.3`	WD40_MABP1-WDR62_2nd	111	280	7.8e-06	25.8
LXL04_015184	`PF23409.2`	Beta-prop_EML	112	200	1.4e-06	28.7
LXL04_015184	`PF24807.2`	WD40_CDC20-Fz	142	327	2.5e-14	54.0
LXL04_015184	`PF25168.2`	Beta-prop_WDR36-Utp21_2nd	142	280	1.4e-07	31.8
LXL04_015184	`PF25173.2`	Beta-prop_WDR3_1st	143	280	5.2e-13	49.8
LXL04_015184	`PF25172.2`	Beta-prop_WDR3_2nd	180	328	5.7e-11	42.9
LXL04_015184	`PF24796.2`	WDR55	181	265	9.3e-06	25.6
LXL04_015184	`PF24817.2`	WD40_WDHD1_1st	210	319	2.9e-08	34.0
LXL04_015184	`PF24814.2`	WD40_Prp19	211	332	1.2e-13	51.5
LXL04_015184	`PF25175.2`	Beta-prop_WDR5	218	333	2.4e-13	50.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NPN9`	Arabidopsis thaliana	WD repeat-containing protein DWA2	74.857%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card