TkA02G380800 | RubberDandelionOmics

Gene overview

TkA02G380800

Reference: TK1151 Chr: Chr02 Coordinates: 96815117-96820265 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2186 bp · TkA02G380800|TK1151|cDNA

GGACCATTCATGTAATTTACTTATTGTTGGCAACATAGAGTCTTTCAGCAGCGACGCCCAACATCTCACCCTTCATCAGCTTGTACCCTAATTCAAGAGAAATTCCTCGTTGTTTTGAAATCTGATTTTTCGCAGTTCAACAAATGGATAATATCGAGGAGGATATTCGCGCTTTGCAATTGGACTCATCTGAAGATAACAACATGGTTACTAATGAGAATGGTGGAGAGCATGAAGAATCCGTAACTCTCAATAAGATG...

CDS

Download CDS FASTA

1563 bp · TkA02G380800|TK1151|CDS

ATGGATAATATCGAGGAGGATATTCGCGCTTTGCAATTGGACTCATCTGAAGATAACAACATGGTTACTAATGAGAATGGTGGAGAGCATGAAGAATCCGTAACTCTCAATAAGATGGAAGAAGATGATTTGAGGGACGACTCACACACTGCGTCCCACATGGAGGAGGATGCAAAGCCCCAGACAGTGCACTCTGATCCTCAAGCTGCAGTTCACGTGACAGAACAAGCCACTGCTCCAGAACCTGTTGAGGAGGAGTC...

Protein

Download Protein FASTA

520 aa · TkA02G380800|TK1151|PROTEIN

MDNIEEDIRALQLDSSEDNNMVTNENGGEHEESVTLNKMEEDDLRDDSHTASHMEEDAKPQTVHSDPQAAVHVTEQATAPEPVEEESEQNKKRHLNVVFIGHVDAGKSTIGGQILYLSGQVDERTIQKYEKEAKDKSRESWYMAYIMDTNEEERAKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMIMGASQADIGLLVISARKGEFETGYERGGQTREHVQLAKTLGVTKLLVVVNKMDDPTVNWSKERYDEIETK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G380800`
TK1151 ID	TkA02G380800
OH-1004 ID	LXL04_014960
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.600
Protein coverage (%)	TK1151 97.115 / OH-1004 94.393 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G380800`
Location	Chr02:96815117-96820265 (+)
Description	Similar to GSPT1: Eukaryotic peptide chain release factor GTP-binding subunit ERF3A
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014960` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000082 G1/S transition of mitotic cell cycle Biological Process GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process GO:0006412 translation Biological Process GO:0006415 translational termination Biological Process GO:0006449 regulation of translational termination Biological Process GO:0006479 protein methylation Biological Process GO:0032790 ribosome disassembly Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0018444 translation release factor complex Cellular Component GO:0022626 cytosolic ribosome Cellular Component GO:0003723 RNA binding Molecular Function
KEGG gene cross-reference	hsa:23708 hsa:2935 mmu:14852 mmu:14853 pon:100174020 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.652

Rank 1 · TkA02G380800 · TK1151

Nucleus0.327

Rank 2 · TkA02G380800 · TK1151

Cell membrane0.112

Rank 3 · TkA02G380800 · TK1151

Mitochondrion0.087

Rank 4 · TkA02G380800 · TK1151

Endoplasmic reticulum0.072

Rank 5 · TkA02G380800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03143GTP_EFTU_D357-76 aa

PF00503G-alpha83-129 aa

PF00009GTP_EFTU92-294 aa

PF01926MMR_HSR197-241 aa

PF22594GTP-eEF1A_C106-135 aa

PF00503G-alpha154-184 aa

PF03144GTP_EFTU_D2156-166 aa

PF22042EF-G_D2333-382 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G380800	`PF03143`	GTP_EFTU_D3	57	76	6.2e-25	88.3
TkA02G380800	`PF00503`	G-alpha	83	129	0.01	15.7
TkA02G380800	`PF00009`	GTP_EFTU	92	294	5.2e-50	170.4
TkA02G380800	`PF01926`	MMR_HSR1	97	241	0.0026	18.6
TkA02G380800	`PF22594`	GTP-eEF1A_C	106	135	4.2e-30	104.9
TkA02G380800	`PF00503`	G-alpha	154	184	0.01	15.7
TkA02G380800	`PF03144`	GTP_EFTU_D2	156	166	8.5e-11	42.8
TkA02G380800	`PF22042`	EF-G_D2	333	382	0.085	13.7
TkA02G380800	`PF03144`	GTP_EFTU_D2	336	402	8.5e-11	42.8
TkA02G380800	`PF14077`	WDR18_C	377	394	0.21	12.2
TkA02G380800	`PF03143`	GTP_EFTU_D3	408	518	6.2e-25	88.3
TkA02G380800	`PF22594`	GTP-eEF1A_C	414	516	4.2e-30	104.9
TkA02G380800	`PF01926`	MMR_HSR1	440	469	0.0026	18.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card