Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1608 bp · LXL04_014960|LXL04_014960|OH1004|cDNA
ATGGGTAAGCGGGATATTGAACTTTTCCCCCTTCAATCGCAGATAATATCGAGGATGACATTCGCGCTTTGCAGTTGGACTCATCTGGTAGCAGAAGATAACAACATGGTTACTAATGAGAATGGTGGAGAGCATGAAGAATCCGTAACTCTCAATAAGATGGAAGAAGATGATTTGAGGGACGACTCACACACTGAGTCCCACATGGAGGAGGATGCAAAGCCCCAGGCAGTGCACTCTGATCCTCAAGCTGCAGTTCA...
1608 bp · LXL04_014960|LXL04_014960|OH1004|CDS
ATGGGTAAGCGGGATATTGAACTTTTCCCCCTTCAATCGCAGATAATATCGAGGATGACATTCGCGCTTTGCAGTTGGACTCATCTGGTAGCAGAAGATAACAACATGGTTACTAATGAGAATGGTGGAGAGCATGAAGAATCCGTAACTCTCAATAAGATGGAAGAAGATGATTTGAGGGACGACTCACACACTGAGTCCCACATGGAGGAGGATGCAAAGCCCCAGGCAGTGCACTCTGATCCTCAAGCTGCAGTTCA...
Protein
Download Protein FASTA535 aa · LXL04_014960|LXL04_014960|OH1004|PROTEIN
MGKRDIELFPLQSQIISRMTFALCSWTHLVAEDNNMVTNENGGEHEESVTLNKMEEDDLRDDSHTESHMEEDAKPQAVHSDPQAAVHVTEQATAPEPVEEESEQNKKRHLNVVFIGHVDAGKSTIGGQILYLSGQVDERTIQKYEKEAKDKSRESWYMAYIMDTNEEERAKGKTVEVGRAHFETETTRFTILDAPGHKSYVPNMIMGASQADIGLLVISARKGEFETGYERGGQTREHVQLAKTLGVTKLLVVVNKMDDP...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_014960 |
|---|---|
| TK1151 ID | TkA02G380800 |
| OH-1004 ID | LXL04_014960 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.600 |
| Protein coverage (%) | TK1151 97.115 / OH-1004 94.393Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_014960 |
|---|---|
| Location | Chr03:60469387-60473812 (-) |
| Description | Similar to GSPT1: Eukaryotic peptide chain release factor GTP-binding subunit ERF3A |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000082 G1/S transition of mitotic cell cycle Biological Process GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process GO:0006412 translation Biological Process GO:0006415 translational termination Biological Process GO:0006449 regulation of translational termination Biological Process GO:0006479 protein methylation Biological Process GO:0032790 ribosome disassembly Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0018444 translation release factor complex Cellular Component GO:0022626 cytosolic ribosome Cellular Component GO:0003723 RNA binding Molecular Function |
| KEGG gene cross-reference | hsa:23708 hsa:2935 mmu:14852 mmu:14853 pon:100174020 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00009.34GTP_EFTU107-309 aaPF03144.32GTP_EFTU_D2351-417 aaPF03143.24GTP_EFTU_D3423-533 aaPF22594.3GTP-eEF1A_C429-531 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_014960 | PF00009.34 | GTP_EFTU | 107 | 309 | 6.1e-50 | 170.1 |
| LXL04_014960 | PF03144.32 | GTP_EFTU_D2 | 351 | 417 | 8.9e-11 | 42.8 |
| LXL04_014960 | PF03143.24 | GTP_EFTU_D3 | 423 | 533 | 1.7e-24 | 86.8 |
| LXL04_014960 | PF22594.3 | GTP-eEF1A_C | 429 | 531 | 1.1e-29 | 103.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.