TkA02G379320 | RubberDandelionOmics

Gene overview

TkA02G379320

Reference: TK1151 Chr: Chr02 Coordinates: 96452341-96454104 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1240 bp · TkA02G379320|TK1151|cDNA

GGCAAACTGGTTTTTAAACCATGGGCCCATAAAATAAAGGAAAAGGCTGAAAGAATCCTAACGAACAAAGTATTCAATCTCTTCAAAACAAGAAAGGAAATAAATAAAGAAAAAAGAAAAAGATTCAACCTCAAATCTTTTCGGGAGTTGGGCAGGCAGCTGACGTGAAATCGAGTTTCCATCCACCTTCCTTCAAATCTTTCAAATACCCCCACATCACAGACATGCATTCTTCACCGATTTCTCTTTAGGGCAAGATT...

CDS

Download CDS FASTA

504 bp · TkA02G379320|TK1151|CDS

ATGATCATGAAACAAGGGGAAGCCAGACAACTAGACGACGACAGCGGCGCCAATGGCGGCGGTGATCCTGCTGCTGGACTGACATACCATCCTCCGATCAATTTCGCCACCGTCGAAGATCGAATCTATAGATCTGGATTCCCTCAGCCAAGTGATTTCCCGTTTCTTGATACATTGCAGCTTCGTTCGGTCATATATTTGTGCACCGAATCATACCCTAAAGCTAATTTGGAATATCTGAATTCTCGCAATATTCGCCT...

Protein

Download Protein FASTA

167 aa · TkA02G379320|TK1151|PROTEIN

MIMKQGEARQLDDDSGANGGGDPAAGLTYHPPINFATVEDRIYRSGFPQPSDFPFLDTLQLRSVIYLCTESYPKANLEYLNSRNIRLFQFGIDGTKVARCEYSKSIITEALKVLIDVRNHPILIHCKRGKHRTGCLVGAYESYKIGGYLRFLKNTRFTQAKNHETRI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G379320`
TK1151 ID	TkA02G379320
OH-1004 ID	LXL04_017580
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	54.900
Protein coverage (%)	TK1151 79.042 / OH-1004 67.857 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G379320

Location Chr02:96452341-96454104 (+)

Description Similar to DSP1: Tyrosine-protein phosphatase DSP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02800`	Cleaves the beta-phosphate at the 5-position of soluble inositol pyrophosphates.	No verified direct reference in this release
`At5g16480`	Cleaves the beta-phosphate at the 5-position of soluble inositol pyrophosphates.	No verified direct reference in this release
`At1g05000`	Cleaves the beta-phosphate at the 5-position of soluble inositol pyrophosphates.	Structural and functional characterization of a novel phosphatase from the Arabidopsis thaliana gene locus At1g05000.2008 · DOI: 10.1002/prot.22041 Phylogenetic and genetic linkage between novel atypical dual-specificity phosphatases from non-metazoan organisms.2011 · DOI: 10.1007/s00438-011-0611-6 A structural exposé of noncanonical molecular reactivity within the protein tyrosine phosphatase WPD loop.2022 · DOI: 10.1038/s41467-022-29673-y Arabidopsis PFA-DSP-Type Phosphohydrolases Target Specific Inositol Pyrophosphate Messengers.2022 · DOI: 10.1021/acs.biochem.2c00145
`At4g03960`	Cleaves the beta-phosphate at the 5-position of soluble inositol pyrophosphates.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0135700`	Cleaves the beta-phosphate at the 5-position of soluble inositol pyrophosphates (By similarity).	OsPFA-DSP1, a rice protein tyrosine phosphatase, negatively regulates drought stress responses in transgenic tobacco and rice plants.2012 · DOI: 10.1007/s00299-011-1220-x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017580 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

GO:1900424 regulation of defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016791 phosphatase activity Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0052845 inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity Molecular Function

GO:0052847 inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity Molecular Function

GO:0052848 inositol-3,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity Molecular Function

GO:0106211 inositol-5-diphosphate-1,3,4,6-tetrakisphosphate diphosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT1G05000

ath:AT2G32960

ath:AT4G03960

dosa:Os02g0771400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.475

Rank 1 · TkA02G379320 · TK1151

Nucleus0.248

Rank 2 · TkA02G379320 · TK1151

Plastid0.140

Rank 3 · TkA02G379320 · TK1151

Mitochondrion0.122

Rank 4 · TkA02G379320 · TK1151

Peroxisome0.101

Rank 5 · TkA02G379320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03162Y_phosphatase231-139 aa

PF13350Y_phosphatase340-67 aa

PF22784PTP-SAK86-140 aa

PF13350Y_phosphatase3104-137 aa

PF22741PTP-NADK106-143 aa

PF22785Tc-R-P106-140 aa

PF00782DSPc109-140 aa

PF00102Y_phosphatase116-139 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G379320	`PF03162`	Y_phosphatase2	31	139	1.9e-36	125.9
TkA02G379320	`PF13350`	Y_phosphatase3	40	67	3.5e-05	24.6
TkA02G379320	`PF22784`	PTP-SAK	86	140	0.019	15.8
TkA02G379320	`PF13350`	Y_phosphatase3	104	137	3.5e-05	24.6
TkA02G379320	`PF22741`	PTP-NADK	106	143	1.7e-05	25.0
TkA02G379320	`PF22785`	Tc-R-P	106	140	0.0047	18.2
TkA02G379320	`PF00782`	DSPc	109	140	9.6e-05	22.9
TkA02G379320	`PF00102`	Y_phosphatase	116	139	0.0053	17.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q681Z2`	Arabidopsis thaliana	sp\|Q681Z2\|DSP3_ARATH Inositol diphosphatase DSP3	64.800%	Swiss-Prot	Medium
`Q9FFD7`	Arabidopsis thaliana	sp\|Q9FFD7\|DSP5_ARATH Inositol diphosphatase DSP5	64.800%	Swiss-Prot	Medium
`Q9ZVN4`	Arabidopsis thaliana	sp\|Q9ZVN4\|DSP1_ARATH Inositol diphosphatase DSP1	61.100%	Swiss-Prot	Medium
`Q940L5`	Arabidopsis thaliana	sp\|Q940L5\|DSP4_ARATH Inositol diphosphatase DSP4	54.900%	Swiss-Prot	Medium
`Q6K461`	Oryza sativa subsp. japonica	sp\|Q6K461\|DSP1_ORYSJ Inositol diphosphatase DSP1	61.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card