TkA02G377030 | RubberDandelionOmics

Gene overview

TkA02G377030

Reference: TK1151 Chr: Chr02 Coordinates: 95901379-95908411 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

768 bp · TkA02G377030|TK1151|cDNA

TCTCTCTCCTCCGAATTTCTCTCTTCTTTCACATTTCGGTTTTCACCAAAATTTTCAGATCTGATAGCCTTGATCGTGATTTGAAAGAATTCATCAATGGCGGATGTGTCACCCCTGGCCAAATACAAGTTGGTATTTTTGGGCGATCAATCCGTCGGCAAAACCAGCATCATTACCAGATTCATGTATGATAAATTCGACGCCACCTATCAGGCTACAGTTGGCATTGATTTTATGTCTAAAGCAGTGTACCTTAAAGA...

CDS

Download CDS FASTA

480 bp · TkA02G377030|TK1151|CDS

ATGGCGGATGTGTCACCCCTGGCCAAATACAAGTTGGTATTTTTGGGCGATCAATCCGTCGGCAAAACCAGCATCATTACCAGATTCATGTATGATAAATTCGACGCCACCTATCAGGCTACAGTTGGCATTGATTTTATGTCTAAAGCAGTGTACCTTAAAGATAGAACATTTCGGTTACATATTTGGGATACTGCTGGGCACGAGAGATTTAGGAGTCTGATTCCAAGTTATATCAAAGATTCATTGGTTGCTGTTAT...

Protein

Download Protein FASTA

159 aa · TkA02G377030|TK1151|PROTEIN

MADVSPLAKYKLVFLGDQSVGKTSIITRFMYDKFDATYQATVGIDFMSKAVYLKDRTFRLHIWDTAGHERFRSLIPSYIKDSLVAVIVYDVANRQSFLNTSKWIEEVRTQLGTKVIIFLVGNKTDLVDKRQVSTEEGENKARELGSCLLLKPVQNLEIY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G377030`
TK1151 ID	TkA02G377030
OH-1004 ID	LXL04_014142
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.200
Protein coverage (%)	TK1151 91.195 / OH-1004 91.124 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G377030

Location Chr02:95901379-95908411 (-)

Description Similar to RABH1E: Ras-related protein RABH1e

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10260`	Protein transport.	No verified direct reference in this release
`At2g22290`	Protein transport.	No verified direct reference in this release
`At2g44610`	Protein transport.	No verified direct reference in this release
`At4g39890`	Protein transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014142 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001558 regulation of cell growth Biological Process

GO:0001881 receptor recycling Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006887 exocytosis Biological Process

GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process

GO:0006891 intra-Golgi vesicle-mediated transport Biological Process

GO:0007602 phototransduction Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0032482 Rab protein signal transduction Biological Process

GO:0042147 retrograde transport, endosome to Golgi Biological Process

GO:0052324 plant-type cell wall cellulose biosynthetic process Biological Process

GO:0060078 regulation of postsynaptic membrane potential Biological Process

KEGG gene cross-reference

ath:AT2G22290

ath:AT2G44610

ath:AT4G39890

ath:AT5G10260

dme:Dmel_CG6601

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.675

Rank 1 · TkA02G377030 · TK1151

Nucleus0.244

Rank 2 · TkA02G377030 · TK1151

Golgi apparatus0.158

Rank 3 · TkA02G377030 · TK1151

Lysosome / Vacuole0.106

Rank 4 · TkA02G377030 · TK1151

Endoplasmic reticulum0.090

Rank 5 · TkA02G377030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03193RsgA_GTPase7-30 aa

PF00025Arf9-132 aa

PF00071Ras11-145 aa

PF08477Roc11-125 aa

PF09439SRPRB11-130 aa

PF04670Gtr1_RagA11-133 aa

PF01926MMR_HSR112-117 aa

PF00009GTP_EFTU42-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G377030	`PF03193`	RsgA_GTPase	7	30	0.11	13.0
TkA02G377030	`PF00025`	Arf	9	132	7.2e-13	49.1
TkA02G377030	`PF00071`	Ras	11	145	2e-47	161.5
TkA02G377030	`PF08477`	Roc	11	125	1.9e-35	122.4
TkA02G377030	`PF09439`	SRPRB	11	130	2.3e-05	24.5
TkA02G377030	`PF04670`	Gtr1_RagA	11	133	0.00051	20.2
TkA02G377030	`PF01926`	MMR_HSR1	12	117	0.00014	22.6
TkA02G377030	`PF00009`	GTP_EFTU	42	133	7.2e-06	26.4
TkA02G377030	`PF19331`	MCCA_BT	47	73	0.019	15.2
TkA02G377030	`PF03193`	RsgA_GTPase	113	147	0.11	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFT9`	Arabidopsis thaliana	sp\|Q9LFT9\|RAH1E_ARATH Ras-related protein RABH1e	84.100%	Swiss-Prot	High
`Q9SID8`	Arabidopsis thaliana	sp\|Q9SID8\|RAH1D_ARATH Ras-related protein RABH1d	80.700%	Swiss-Prot	High
`O80501`	Arabidopsis thaliana	sp\|O80501\|RAH1B_ARATH Ras-related protein RABH1b	81.900%	Swiss-Prot	High
`Q9SMR4`	Arabidopsis thaliana	sp\|Q9SMR4\|RAH1C_ARATH Ras-related protein RABH1c	76.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card