TkA02G372250 | RubberDandelionOmics

Gene overview

TkA02G372250

Reference: TK1151 Chr: Chr02 Coordinates: 94762405-94765093 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1574 bp · TkA02G372250|TK1151|cDNA

TATATACTCAGCTATCCATGGCTTCAGCGTCCTTCGCTTGTTGGAGTCGATTGCCGGAGACCCACATTTTTAAGCCCTAGAAACTTGCAGTAATCGAACCCCAATTCGTTCACCGACTCAATTGACATGTTGCAGTGTATATTTCTCCTCTCCGTCCGATTCCGAGAGGTGATACTCGAGAAGCAGCTGACTGGGCATCGCGTTGATCGATCGATATGTGCTTGGTTTTGGGAGCAAACGATCTCTCAACCTGATTCCCT...

CDS

Download CDS FASTA

1263 bp · TkA02G372250|TK1151|CDS

ATGTTGCAGTGTATATTTCTCCTCTCCGTCCGATTCCGAGAGGTGATACTCGAGAAGCAGCTGACTGGGCATCGCGTTGATCGATCGATATGTGCTTGGTTTTGGGAGCAAACGATCTCTCAACCTGATTCCCTCAAGGTATTGCCAGTAATTGCTTCACCGACGCATTACCTTTTCCAAATTGTACGTGAAGGGATCACATTTTTAGCCTGCACTCAAGTTGAAATGCCACCTTTAATGGGAATAGAGAATATCTTTAT...

Protein

Download Protein FASTA

420 aa · TkA02G372250|TK1151|PROTEIN

MLQCIFLLSVRFREVILEKQLTGHRVDRSICAWFWEQTISQPDSLKVLPVIASPTHYLFQIVREGITFLACTQVEMPPLMGIENIFISFQVTLIMMPSDKPFPIIVADVLSDYLGGLNEDVIKDNFVIVYELLDEMIDNGFPLTTEPNILRDMIAPPNIVSKMLSVVTGTTSNVSDTLPGATSSCVPWRTTQLKHANNDVDGMLVKCEIFGLVEVNSHLSGVPDLTLSLANPSILNDVQFHPCVRFRPWESEQILSFVPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G372250`
TK1151 ID	TkA02G372250
OH-1004 ID	LXL04_015045
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.600
Protein coverage (%)	TK1151 97.143 / OH-1004 95.781 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G372250

Location Chr02:94762405-94765093 (+)

Description Similar to AP3M: AP-3 complex subunit mu

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g56590`	Part of the AP-3 complex, an adaptor-related complex which seems to be clathrin-associated.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015045 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006622 protein targeting to lysosome Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006896 Golgi to vacuole transport Biological Process

GO:0006897 endocytosis Biological Process

GO:0009630 gravitropism Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0035654 clathrin-coated vesicle cargo loading, AP-3-mediated Biological Process

GO:0060155 platelet dense granule organization Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005764 lysosome Cellular Component

GO:0005765 lysosomal membrane Cellular Component

GO:0005769 early endosome Cellular Component

KEGG gene cross-reference

ath:AT1G56590

gga:423736

hsa:26985

mmu:55946

pon:100174037

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.554

Rank 1 · TkA02G372250 · TK1151

Golgi apparatus0.404

Rank 2 · TkA02G372250 · TK1151

Nucleus0.138

Rank 3 · TkA02G372250 · TK1151

Lysosome / Vacuole0.129

Rank 4 · TkA02G372250 · TK1151

Endoplasmic reticulum0.129

Rank 5 · TkA02G372250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00928Adap_comp_sub201-419 aa

PF24341OB_DEPS-1_6th204-222 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G372250	`PF00928`	Adap_comp_sub	201	419	1.6e-54	185.7
TkA02G372250	`PF24341`	OB_DEPS-1_6th	204	222	0.072	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I562`	Arabidopsis thaliana	sp\|F4I562\|AP3M_ARATH AP-3 complex subunit mu	68.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card