LXL04_015045 | RubberDandelionOmics

Gene overview

LXL04_015045

Reference: OH-1004 Chr: Chr03 Coordinates: 62494182-62496457 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1425 bp · LXL04_015045|LXL04_015045|OH1004|cDNA

ATGGTAATGTTTGGGCTTGTTAAATTAAAATTAACGATTGCAATCTGCAATTTCATTTCCAGAGAGGTGATACTCGAGAAGCAGCTGACTGGGCATCGCGTTGATCGATCGATATGTGCTTGGTTTTGGGAGCAAACGATCTCTCAACCTGATTCCCTCAAGGTATTGCCAGTAATTGCTTCACCGACGCATTACCTTTTCCAAATTGTACGTGAAGGGATCACATTTTTAGCCTGCACTCAAGTTGAAATGCCACCTTT...

CDS

Download CDS FASTA

1425 bp · LXL04_015045|LXL04_015045|OH1004|CDS

ATGGTAATGTTTGGGCTTGTTAAATTAAAATTAACGATTGCAATCTGCAATTTCATTTCCAGAGAGGTGATACTCGAGAAGCAGCTGACTGGGCATCGCGTTGATCGATCGATATGTGCTTGGTTTTGGGAGCAAACGATCTCTCAACCTGATTCCCTCAAGGTATTGCCAGTAATTGCTTCACCGACGCATTACCTTTTCCAAATTGTACGTGAAGGGATCACATTTTTAGCCTGCACTCAAGTTGAAATGCCACCTTT...

Protein

Download Protein FASTA

474 aa · LXL04_015045|LXL04_015045|OH1004|PROTEIN

MVMFGLVKLKLTIAICNFISREVILEKQLTGHRVDRSICAWFWEQTISQPDSLKVLPVIASPTHYLFQIVREGITFLACTQVEMPPLMGIENIFISFQVTLIMMPSDKPFPIIVADVLSDYLGGLNEDVIKDNFVIVYELLDEMIDNGFPLTTEPNILRDMIAPPNIVSKMLSVVTGTTSNVSDTLPGATSSCVPWRTTQLKHANNDVYVNLIEEMDTIINRHALYFPLVFFDKVLGLNSRNSYLFFVDFVVFSDGMLVK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015045`
TK1151 ID	TkA02G372250
OH-1004 ID	LXL04_015045
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.600
Protein coverage (%)	TK1151 97.143 / OH-1004 95.781 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015045

Location Chr03:62494182-62496457 (-)

Description Similar to AP3M: AP-3 complex subunit mu

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g56590`	Part of the AP-3 complex, an adaptor-related complex which seems to be clathrin-associated.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015045 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006622 protein targeting to lysosome Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006896 Golgi to vacuole transport Biological Process

GO:0006897 endocytosis Biological Process

GO:0009630 gravitropism Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0035654 clathrin-coated vesicle cargo loading, AP-3-mediated Biological Process

GO:0060155 platelet dense granule organization Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005764 lysosome Cellular Component

GO:0005765 lysosomal membrane Cellular Component

GO:0005769 early endosome Cellular Component

KEGG gene cross-reference

ath:AT1G56590

gga:423736

hsa:26985

mmu:55946

pon:100174037

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.490

Rank 1 · LXL04_015045 · OH-1004

Golgi apparatus0.456

Rank 2 · LXL04_015045 · OH-1004

Endoplasmic reticulum0.156

Rank 3 · LXL04_015045 · OH-1004

Nucleus0.129

Rank 4 · LXL04_015045 · OH-1004

Lysosome / Vacuole0.111

Rank 5 · LXL04_015045 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00928.27Adap_comp_sub248-473 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015045	`PF00928.27`	Adap_comp_sub	248	473	4.3e-60	204.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I562`	Arabidopsis thaliana	AP-3 complex subunit mu	66.520%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card