TkA02G362730 | RubberDandelionOmics

Gene overview

TkA02G362730

Reference: TK1151 Chr: Chr02 Coordinates: 92263648-92268228 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2560 bp · TkA02G362730|TK1151|cDNA

CACTTTTTCTATATTACTTCCTCCCTCTATAAGTCTATATTCACATATATTTCTATATATATGTACGTATATATGTGAGTTGTGAGCATAACTCTAATTAAGGCAAAAGGCATGAAAGGTTTATATGTTTTGTGTAGGTTGATCTTTATAATAAGTTTGGTGAGAGAAATTAAGGCCGATGAAGGAGAGAGTGATGGTGTTTATATCGTGTACATGGGTGCTGCTGCTAACTCAAGGGACAACCATGACCTACTTCTCAC...

CDS

Download CDS FASTA

2256 bp · TkA02G362730|TK1151|CDS

ATGAAAGGTTTATATGTTTTGTGTAGGTTGATCTTTATAATAAGTTTGGTGAGAGAAATTAAGGCCGATGAAGGAGAGAGTGATGGTGTTTATATCGTGTACATGGGTGCTGCTGCTAACTCAAGGGACAACCATGACCTACTTCTCACTTCCCTAGCAACAAGAGATAGGAACCCAATCGTGCATAACTACCAAAATAGCTTCTTGGGATTTGCTGCTCGTTTAACCGAAAAAGAGGCGAAAGATATGGAACAAAAACC...

Protein

Download Protein FASTA

751 aa · TkA02G362730|TK1151|PROTEIN

MKGLYVLCRLIFIISLVREIKADEGESDGVYIVYMGAAANSRDNHDLLLTSLATRDRNPIVHNYQNSFLGFAARLTEKEAKDMEQKPGVVSVFPDPVLQLHTTRSWDFLKYQTEVEKEFTPNEGSNAPSDIIIGVLDTGIWPESESFGDEGFGPVPSKWKGTCMQGREFTSSHCNRKIIGARFYRTFGDYNTPRDMVGHGTHVASTAAGNTVSNASYYGLAMGSAKGGFPGARIAMYRVCGARGCLGSVILKAFDDAIAD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G362730`
TK1151 ID	TkA02G362730
OH-1004 ID	LXL04_015135
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 98.802 / OH-1004 99.331 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G362730

Location Chr02:92263648-92268228 (+)

Description Similar to CRSP: CO(2)-response secreted protease

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20160`	May cleave EPF2 peptide and participate in CO₂-regulated stomatal development.	Carbonic anhydrases, EPF2 and a novel protease mediate CO2 control of stomatal development.2014 · DOI: 10.1038/nature13452
`At1g20150`	Subtilisin-like protease SBT5.1.	No verified direct reference in this release
`At5g67360`	Serine protease.	Ara12 subtilisin-like protease from Arabidopsis thaliana: purification, substrate specificity and tissue localization.2003 · DOI: 10.1042/bj20021125 A subtilisin-like serine protease essential for mucilage release from Arabidopsis seed coats.2008 · DOI: 10.1111/j.1365-313x.2008.03437.x
`At5g59100`	Subtilisin-like protease SBT4.4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015135 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009609 response to symbiotic bacterium Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009733 response to auxin Biological Process

GO:0010037 response to carbon dioxide Biological Process

GO:0010102 lateral root morphogenesis Biological Process

GO:0010214 seed coat development Biological Process

GO:0036377 arbuscular mycorrhizal association Biological Process

GO:0080001 mucilage extrusion from seed coat Biological Process

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:2000038 regulation of stomatal complex development Biological Process

GO:2000122 negative regulation of stomatal complex development Biological Process

KEGG gene cross-reference

ath:AT1G20150

ath:AT1G20160

ath:AT2G04160

ath:AT5G67360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.773

Rank 1 · TkA02G362730 · TK1151

Cell membrane0.076

Rank 2 · TkA02G362730 · TK1151

Lysosome / Vacuole0.069

Rank 3 · TkA02G362730 · TK1151

Cytoplasm0.049

Rank 4 · TkA02G362730 · TK1151

Endoplasmic reticulum0.036

Rank 5 · TkA02G362730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05922Inhibitor_I930-101 aa

PF21864MORF_dom66-100 aa

PF17265DUF5331103-137 aa

PF00082Peptidase_S8130-591 aa

PF02225PA358-451 aa

PF17265DUF5331523-555 aa

PF21864MORF_dom608-626 aa

PF17766fn3_6654-749 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G362730	`PF05922`	Inhibitor_I9	30	101	1.4e-15	58.4
TkA02G362730	`PF21864`	MORF_dom	66	100	0.0092	16.5
TkA02G362730	`PF17265`	DUF5331	103	137	0.25	11.8
TkA02G362730	`PF00082`	Peptidase_S8	130	591	1.3e-46	159.9
TkA02G362730	`PF02225`	PA	358	451	9.3e-08	32.8
TkA02G362730	`PF17265`	DUF5331	523	555	0.25	11.8
TkA02G362730	`PF21864`	MORF_dom	608	626	0.0092	16.5
TkA02G362730	`PF17766`	fn3_6	654	749	8.1e-29	100.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LNU1`	Arabidopsis thaliana	sp\|Q9LNU1\|CRSP_ARATH CO(2)-response secreted protease	53.500%	Swiss-Prot	High
`F4HSQ2`	Arabidopsis thaliana	sp\|F4HSQ2\|SBT51_ARATH Subtilisin-like protease SBT5.1	50.800%	Swiss-Prot	High
`O65351`	Arabidopsis thaliana	sp\|O65351\|SBT17_ARATH Subtilisin-like protease SBT1.7	42.400%	Swiss-Prot	Medium
`Q9FGU3`	Arabidopsis thaliana	sp\|Q9FGU3\|SBT44_ARATH Subtilisin-like protease SBT4.4	40.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card