LXL04_015135 | RubberDandelionOmics

Gene overview

LXL04_015135

Reference: OH-1004 Chr: Chr03 Coordinates: 64692029-64696377 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2244 bp · LXL04_015135|LXL04_015135|OH1004|cDNA

atgtaCGTATATATGTTGATCTTTATAATAAGTTTGGTGAGAGAAATTAAGGCCGATGAAGGAGAGAGTGATGGTGTTTATATCGTGTACATGGGTGCTGCTGCTAACTCAAGGGACAACCATGACCTACTTCTCACTTCCCTAGCAACAAGAGATAGGAACCCAATCGTGCATAACTACCAAAACAGCTTCTTGGGATTTGCTGCTCGTTTAACCAAAAAAGAGGCAAAAGATATGGAACAAAAACCAGGGGTAGTTTC...

CDS

Download CDS FASTA

2244 bp · LXL04_015135|LXL04_015135|OH1004|CDS

ATGTACGTATATATGTTGATCTTTATAATAAGTTTGGTGAGAGAAATTAAGGCCGATGAAGGAGAGAGTGATGGTGTTTATATCGTGTACATGGGTGCTGCTGCTAACTCAAGGGACAACCATGACCTACTTCTCACTTCCCTAGCAACAAGAGATAGGAACCCAATCGTGCATAACTACCAAAACAGCTTCTTGGGATTTGCTGCTCGTTTAACCAAAAAAGAGGCAAAAGATATGGAACAAAAACCAGGGGTAGTTTC...

Protein

Download Protein FASTA

747 aa · LXL04_015135|LXL04_015135|OH1004|PROTEIN

MYVYMLIFIISLVREIKADEGESDGVYIVYMGAAANSRDNHDLLLTSLATRDRNPIVHNYQNSFLGFAARLTKKEAKDMEQKPGVVSVFPDPVLQLHTTRSWDFLKYQTEVEKEFTPNEGSNAPSDIIIGVLDTGIWPESESFGDEGFGPVPSKWKGTCMQGREFTSSHCNRKIIGARFYRTFGDYNTPRDMVGHGTHVASTAAGNTVSNASYYGLAMGSAKGGFPGARIAMYRVCGARGCLGSVILKAFDDAIADGVDV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015135`
TK1151 ID	TkA02G362730
OH-1004 ID	LXL04_015135
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 98.802 / OH-1004 99.331 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015135

Location Chr03:64692029-64696377 (-)

Description Similar to CRSP: CO(2)-response secreted protease

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20160`	May cleave EPF2 peptide and participate in CO₂-regulated stomatal development.	Carbonic anhydrases, EPF2 and a novel protease mediate CO2 control of stomatal development.2014 · DOI: 10.1038/nature13452
`At1g20150`	Subtilisin-like protease SBT5.1.	No verified direct reference in this release
`At5g67360`	Serine protease.	Ara12 subtilisin-like protease from Arabidopsis thaliana: purification, substrate specificity and tissue localization.2003 · DOI: 10.1042/bj20021125 A subtilisin-like serine protease essential for mucilage release from Arabidopsis seed coats.2008 · DOI: 10.1111/j.1365-313x.2008.03437.x
`At2g04160`	Serine protease.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015135 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009609 response to symbiotic bacterium Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009733 response to auxin Biological Process

GO:0010037 response to carbon dioxide Biological Process

GO:0010102 lateral root morphogenesis Biological Process

GO:0010214 seed coat development Biological Process

GO:0036377 arbuscular mycorrhizal association Biological Process

GO:0080001 mucilage extrusion from seed coat Biological Process

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:2000038 regulation of stomatal complex development Biological Process

GO:2000122 negative regulation of stomatal complex development Biological Process

KEGG gene cross-reference

ath:AT1G20150

ath:AT1G20160

ath:AT2G04160

ath:AT5G67360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.774

Rank 1 · LXL04_015135 · OH-1004

Cell membrane0.076

Rank 2 · LXL04_015135 · OH-1004

Lysosome / Vacuole0.067

Rank 3 · LXL04_015135 · OH-1004

Cytoplasm0.049

Rank 4 · LXL04_015135 · OH-1004

Endoplasmic reticulum0.035

Rank 5 · LXL04_015135 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05922.22Inhibitor_I926-97 aa

PF00082.28Peptidase_S8126-590 aa

PF02225.28PA354-447 aa

PF17766.8fn3_6650-745 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015135	`PF05922.22`	Inhibitor_I9	26	97	2.3e-15	57.8
LXL04_015135	`PF00082.28`	Peptidase_S8	126	590	2.7e-47	162.2
LXL04_015135	`PF02225.28`	PA	354	447	9.3e-08	32.8
LXL04_015135	`PF17766.8`	fn3_6	650	745	6.9e-29	100.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LNU1`	Arabidopsis thaliana	CO(2)-response secreted protease	53.386%	Swiss-Prot	strong database homology
`F4HSQ2`	Arabidopsis thaliana	Subtilisin-like protease SBT5.1	51.044%	Swiss-Prot	strong database homology
`O65351`	Arabidopsis thaliana	Subtilisin-like protease SBT1.7	42.428%	Swiss-Prot	moderate database homology
`Q9ZSP5`	Arabidopsis thaliana	Subtilisin-like protease SBT5.3	40.053%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card