TkA02G361850 | RubberDandelionOmics

Gene overview

TkA02G361850

Reference: TK1151 Chr: Chr02 Coordinates: 92025951-92031585 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

684 bp · TkA02G361850|TK1151|cDNA

ATGTTGATGCAGTTGCTTAGGGAGATATCCCATGATAACGTGGTAAAGCTGGTGAATGTGCACATCAATCATATTGACATGTCACTCTATCTGGCTTTTGATTATGCAGAGCACGACCTTTATGAAATTATCAGACATCATAGAGACAAGGTCAACCAAGCTAGCAACCAATACACAGTGAAGTCAATACTTTGGCAGTTGCTTAATGGGCTAAATTATCTTCCTAAGGTTATGGGTGATGGAGAAGAACAAGGAGTTGT...

CDS

Download CDS FASTA

684 bp · TkA02G361850|TK1151|CDS

ATGTTGATGCAGTTGCTTAGGGAGATATCCCATGATAACGTGGTAAAGCTGGTGAATGTGCACATCAATCATATTGACATGTCACTCTATCTGGCTTTTGATTATGCAGAGCACGACCTTTATGAAATTATCAGACATCATAGAGACAAGGTCAACCAAGCTAGCAACCAATACACAGTGAAGTCAATACTTTGGCAGTTGCTTAATGGGCTAAATTATCTTCCTAAGGTTATGGGTGATGGAGAAGAACAAGGAGTTGT...

Protein

Download Protein FASTA

227 aa · TkA02G361850|TK1151|PROTEIN

MLMQLLREISHDNVVKLVNVHINHIDMSLYLAFDYAEHDLYEIIRHHRDKVNQASNQYTVKSILWQLLNGLNYLPKVMGDGEEQGVVKIADFGLARIYQAPLKPLFDNGVVVTIWYRAPELLLGGKHYTSAVDMWAVGCIFAELLTLKPLFQGQEVKATPNPFQACSMTGSVDIALGLHILESFPNMVENVQVSMGTKTRGNAFVAFGALSHYGFRIQGDSFLEHVS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G361850`
TK1151 ID	TkA02G361850
OH-1004 ID	LXL04_033547
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.300
Protein coverage (%)	TK1151 96.035 / OH-1004 74.138 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G361850

Location Chr02:92025951-92031585 (+)

Description Similar to CDKE-1: Cyclin-dependent kinase E-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63610`	Involved in cell differentiation.	HUA ENHANCER3 reveals a role for a cyclin-dependent protein kinase in the specification of floral organ identity in Arabidopsis.2004 · DOI: 10.1242/dev.01187

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0580300`	Cyclin-dependent kinase E-1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033547 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000082 G1/S transition of mitotic cell cycle Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0010344 seed oilbody biogenesis Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0034472 snRNA 3'-end processing Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0050821 protein stabilization Biological Process

GO:0051301 cell division Biological Process

GO:0090209 negative regulation of triglyceride metabolic process Biological Process

GO:0000151 ubiquitin ligase complex Cellular Component

KEGG gene cross-reference

ath:AT5G63610

ddi:DDB_G0267442

dme:Dmel_CG10572

dosa:Os10g0580300

mmu:264064

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.563

Rank 1 · TkA02G361850 · TK1151

Nucleus0.363

Rank 2 · TkA02G361850 · TK1151

Mitochondrion0.104

Rank 3 · TkA02G361850 · TK1151

Endoplasmic reticulum0.082

Rank 4 · TkA02G361850 · TK1151

Peroxisome0.066

Rank 5 · TkA02G361850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr3-75 aa

PF00069Pkinase4-158 aa

PF07714PK_Tyr_Ser-Thr83-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G361850	`PF07714`	PK_Tyr_Ser-Thr	3	75	2.9e-13	50.5
TkA02G361850	`PF00069`	Pkinase	4	158	2.3e-28	100.0
TkA02G361850	`PF07714`	PK_Tyr_Ser-Thr	83	147	2.9e-13	50.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84TI6`	Arabidopsis thaliana	sp\|Q84TI6\|CDKE1_ARATH Cyclin-dependent kinase E-1	72.200%	Swiss-Prot	High
`Q336M2`	Oryza sativa subsp. japonica	sp\|Q336M2\|CDKE1_ORYSJ Cyclin-dependent kinase E-1	73.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card