TkA02G356270 | RubberDandelionOmics

Gene overview

TkA02G356270

Reference: TK1151 Chr: Chr02 Coordinates: 90487288-90489892 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2021 bp · TkA02G356270|TK1151|cDNA

TAAAAACCGACATAGTTTCTTAGCAACTGTAAATCTTTTCCCGGTATATACATTAATTGTCCTTGTGATAGTAATATCCATCAGCAATTAATTGTTCCTCCTCCTCCTCCGATCACCACAATCGCAAGAAGATGTCAAACATGGTGGATAACAAGCAGGAAGGCAAATCTGTAGATCTCAAAACCTCTAAAGCAACTTCTTCCTCTCCATCGGTGGTGGAAAACGTAGATCTCAGCATCAACAATTCCAGTTACCGTCAT...

CDS

Download CDS FASTA

1674 bp · TkA02G356270|TK1151|CDS

ATGTCAAACATGGTGGATAACAAGCAGGAAGGCAAATCTGTAGATCTCAAAACCTCTAAAGCAACTTCTTCCTCTCCATCGGTGGTGGAAAACGTAGATCTCAGCATCAACAATTCCAGTTACCGTCATCAACTCAGCCGCCGTACCATGACTTTGTCTCCCTCTTTGAGGCGTACTGAGTCCAACAGAAATGCGACTGTGAACGAGAGTGTGATTAAGGGGATGGCTACAGCCATGGACGCGGTGGTGAAGGTGTTCTG...

Protein

Download Protein FASTA

557 aa · TkA02G356270|TK1151|PROTEIN

MSNMVDNKQEGKSVDLKTSKATSSSPSVVENVDLSINNSSYRHQLSRRTMTLSPSLRRTESNRNATVNESVIKGMATAMDAVVKVFCIHTEPNFSLPWQRNRQYSSNSTGFVISGRRVLTNAHSVDHYTQVKLKKRGSDTKYVATVLAVGMECDIALLTVDEDEFWDGVSPVEFGDLPALQDAVTVVGYPVGGDTISVTSGVVSRIEILSYGHGSELLGLQIDAAINPGNSGGPAFNAKGDCVGIAFMSLMGQDVENIGY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G356270`
TK1151 ID	TkA02G356270
OH-1004 ID	LXL04_015206
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G356270

Location Chr02:90487288-90489892 (-)

Description Similar to DEGP9: Protease Do-like 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40200`	Serine protease that degrades the two-component response regulator ARR4.	No verified direct reference in this release
`At2g47940`	Serine protease that performs the primary cleavage of the photodamaged D1 protein in plant photosystem II.	A chloroplast DegP2 protease performs the primary cleavage of the photodamaged D1 protein in plant photosystem II.2001 · DOI: 10.1093/emboj/20.4.713
`At5g36950`	Probable serine protease.	No verified direct reference in this release
`At1g65630`	Putative serine protease.	No verified direct reference in this release
`At1g65640`	Putative serine protease.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015206 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0010206 photosystem II repair Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009533 chloroplast stromal thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT1G65630

ath:AT1G65640

ath:AT2G47940

ath:AT5G36950

ath:AT5G40200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.586

Rank 1 · TkA02G356270 · TK1151

Nucleus0.325

Rank 2 · TkA02G356270 · TK1151

Cell membrane0.103

Rank 3 · TkA02G356270 · TK1151

Plastid0.067

Rank 4 · TkA02G356270 · TK1151

Endoplasmic reticulum0.066

Rank 5 · TkA02G356270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00089Trypsin94-271 aa

PF13365Trypsin_2109-245 aa

PF10459Peptidase_S46226-249 aa

PF13180PDZ_2303-385 aa

PF17815PDZ_3394-539 aa

PF13180PDZ_2475-496 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G356270	`PF00089`	Trypsin	94	271	1.6e-20	74.6
TkA02G356270	`PF13365`	Trypsin_2	109	245	3.2e-24	87.1
TkA02G356270	`PF10459`	Peptidase_S46	226	249	0.047	13.0
TkA02G356270	`PF13180`	PDZ_2	303	385	2.2e-06	28.6
TkA02G356270	`PF17815`	PDZ_3	394	539	1.4e-48	165.0
TkA02G356270	`PF13180`	PDZ_2	475	496	2.2e-06	28.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FL12`	Arabidopsis thaliana	sp\|Q9FL12\|DEGP9_ARATH Protease Do-like 9	74.000%	Swiss-Prot	High
`O82261`	Arabidopsis thaliana	sp\|O82261\|DEGP2_ARATH Protease Do-like 2, chloroplastic	51.500%	Swiss-Prot	High
`Q9FIV6`	Arabidopsis thaliana	sp\|Q9FIV6\|DGP10_ARATH Protease Do-like 10, mitochondrial	49.600%	Swiss-Prot	Medium
`Q9SHZ1`	Arabidopsis thaliana	sp\|Q9SHZ1\|DEGP3_ARATH Putative protease Do-like 3, mitochondrial	46.200%	Swiss-Prot	Medium
`Q9SHZ0`	Arabidopsis thaliana	sp\|Q9SHZ0\|DEGP4_ARATH Protease Do-like 4, mitochondrial	42.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card