TkA02G351220 | RubberDandelionOmics

Gene overview

TkA02G351220

Reference: TK1151 Chr: Chr02 Coordinates: 89339032-89339919 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

888 bp · TkA02G351220|TK1151|cDNA

ATGGAACCAATGATTTCAAGAAACCCATCATCAGAGCTACCCCTACTCAAAAAAATATTTAAAGCACTTGATAGAGCTATCATCAAGTTCATCGATCCTCCACTTCATGAGTCAGTCAACCCGACCCACATCATATCCGACAATTCCGCGCCTGTTGAAGAACTAAGCCCCACCCAATGCGACGTCGTACATGGGTCCATCCCTCCATGCCTTAACGGTGCATACATCCGTAACGGACCGAACCCACAGTTCCAACCCAC...

CDS

Download CDS FASTA

888 bp · TkA02G351220|TK1151|CDS

ATGGAACCAATGATTTCAAGAAACCCATCATCAGAGCTACCCCTACTCAAAAAAATATTTAAAGCACTTGATAGAGCTATCATCAAGTTCATCGATCCTCCACTTCATGAGTCAGTCAACCCGACCCACATCATATCCGACAATTCCGCGCCTGTTGAAGAACTAAGCCCCACCCAATGCGACGTCGTACATGGGTCCATCCCTCCATGCCTTAACGGTGCATACATCCGTAACGGACCGAACCCACAGTTCCAACCCAC...

Protein

Download Protein FASTA

295 aa · TkA02G351220|TK1151|PROTEIN

MEPMISRNPSSELPLLKKIFKALDRAIIKFIDPPLHESVNPTHIISDNSAPVEELSPTQCDVVHGSIPPCLNGAYIRNGPNPQFQPTGPHHNLDGDRMVHSVRISHGQATLCSRYVKTNKYLIEDQLKSFIVPNVIGGMQEIGPFLARGTLFLARVVSGHYDANKGIDVANTNLAFLGNRLYALCESDLPYEIKIRDDGDIITLGHDDFDGKLVMNMTAHPKIDPGTKEAFSFRYWATRPYLTYFRFDANGNKQSDVPIF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G351220`
TK1151 ID	TkA02G351220
OH-1004 ID	LXL04_015256
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	89.800
Protein coverage (%)	TK1151 99.661 / OH-1004 49.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G351220

Location Chr02:89339032-89339919 (+)

Description Similar to CCD4: Probable carotenoid cleavage dioxygenase 4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g19170`	May be involved in carotenoid cleavage.	No verified direct reference in this release
`At1g30100`	Has a 11,12(11',12') 9-cis epoxycarotenoid cleavage activity.	No verified direct reference in this release
`At4g18350`	Has a 11,12(11',12') 9-cis epoxycarotenoid cleavage activity.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0704000`	Has a 11,12(11',12') 9-cis epoxycarotenoid cleavage activity.	No verified direct reference in this release
`Os12g0435200`	Has a 11,12(11',12') 9-cis epoxycarotenoid cleavage activity.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015256 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009688 abscisic acid biosynthetic process Biological Process

GO:0016121 carotene catabolic process Biological Process

GO:1901811 beta-carotene catabolic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009509 chromoplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0010287 plastoglobule Cellular Component

GO:0010436 carotenoid dioxygenase activity Molecular Function

GO:0045549 9-cis-epoxycarotenoid dioxygenase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G19170

dosa:Os02g0704000

dosa:Os12g0435200

osa:4330451

osa:4352125

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.700

Rank 1 · TkA02G351220 · TK1151

Mitochondrion0.150

Rank 2 · TkA02G351220 · TK1151

Cytoplasm0.095

Rank 3 · TkA02G351220 · TK1151

Cell membrane0.058

Rank 4 · TkA02G351220 · TK1151

Peroxisome0.047

Rank 5 · TkA02G351220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03055RPE6552-291 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G351220	`PF03055`	RPE65	52	291	1.6e-59	202.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49675`	Arabidopsis thaliana	sp\|O49675\|CCD4_ARATH Probable carotenoid cleavage dioxygenase 4, chloroplastic	56.500%	Swiss-Prot	High
`Q9C6Z1`	Arabidopsis thaliana	sp\|Q9C6Z1\|NCED5_ARATH Probable 9-cis-epoxycarotenoid dioxygenase NCED5, chloroplastic	41.900%	Swiss-Prot	Medium
`O49505`	Arabidopsis thaliana	sp\|O49505\|NCED2_ARATH 9-cis-epoxycarotenoid dioxygenase NCED2, chloroplastic	40.600%	Swiss-Prot	Medium
`Q6YVJ0`	Oryza sativa subsp. japonica	sp\|Q6YVJ0\|NCED1_ORYSJ 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic	50.700%	Swiss-Prot	High
`Q5MBR6`	Oryza sativa subsp. japonica	sp\|Q5MBR6\|NCED2_ORYSJ 9-cis-epoxycarotenoid dioxygenase NCED2, chloroplastic	47.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card