LXL04_015256 | RubberDandelionOmics

Gene overview

LXL04_015256

Reference: OH-1004 Chr: Chr03 Coordinates: 66992082-66993969 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1803 bp · LXL04_015256|LXL04_015256|OH1004|cDNA

ATGGAAGCATTCCCCACCTCAATGCATTCGCTTTTCTTGTGTCACGAAAATCTCAATTTCCATTCTCCTATCAAGACCGTGAAATCTCGGCCAACTTCTATTGTTTCCGTTATGGGAATCAACGAAGGAGTTCATGGAGCAAGATTAACAAAAAAGAATCACCACCAACAACAAATTCCGACAATCATGGAACCAATGAAATCAAGAAAACCATCATCAGAGCTACCCCTACTCAAAAAAATATTTAAAGAACTTGATAA...

CDS

Download CDS FASTA

1803 bp · LXL04_015256|LXL04_015256|OH1004|CDS

ATGGAAGCATTCCCCACCTCAATGCATTCGCTTTTCTTGTGTCACGAAAATCTCAATTTCCATTCTCCTATCAAGACCGTGAAATCTCGGCCAACTTCTATTGTTTCCGTTATGGGAATCAACGAAGGAGTTCATGGAGCAAGATTAACAAAAAAGAATCACCACCAACAACAAATTCCGACAATCATGGAACCAATGAAATCAAGAAAACCATCATCAGAGCTACCCCTACTCAAAAAAATATTTAAAGAACTTGATAA...

Protein

Download Protein FASTA

600 aa · LXL04_015256|LXL04_015256|OH1004|PROTEIN

MEAFPTSMHSLFLCHENLNFHSPIKTVKSRPTSIVSVMGINEGVHGARLTKKNHHQQQIPTIMEPMKSRKPSSELPLLKKIFKELDKAIIKFIDPPLHDSVNPTHILSDNSAPVEELIPTQCDVVHGSIPPCLDGAYIRNGPNPQFQPTGPHHSLDGDGMVHSVRIFDGQATLCSRYVKTNKYLIEHQLKSFIVPNVIGGMQEIGPFLARGALFLARLISGHYDATKGIGVANTNLAFLGGRLYALCESDLPYEIKVRDD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015256`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015256

Location Chr03:66992082-66993969 (-)

Description Similar to CCD4: Probable carotenoid cleavage dioxygenase 4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g19170`	May be involved in carotenoid cleavage.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0704000`	Has a 11,12(11',12') 9-cis epoxycarotenoid cleavage activity.	No verified direct reference in this release
`Os12g0435200`	Has a 11,12(11',12') 9-cis epoxycarotenoid cleavage activity.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015256 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009688 abscisic acid biosynthetic process Biological Process

GO:0016121 carotene catabolic process Biological Process

GO:1901811 beta-carotene catabolic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009509 chromoplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0010287 plastoglobule Cellular Component

GO:0010436 carotenoid dioxygenase activity Molecular Function

GO:0045549 9-cis-epoxycarotenoid dioxygenase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G19170

dosa:Os02g0704000

dosa:Os12g0435200

osa:4330451

osa:4352125

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.962

Rank 1 · LXL04_015256 · OH-1004

Mitochondrion0.051

Rank 2 · LXL04_015256 · OH-1004

Cytoplasm0.031

Rank 3 · LXL04_015256 · OH-1004

Peroxisome0.024

Rank 4 · LXL04_015256 · OH-1004

Cell membrane0.022

Rank 5 · LXL04_015256 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03055.22RPE65113-592 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015256	`PF03055.22`	RPE65	113	592	4.8e-119	399.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49675`	Arabidopsis thaliana	Probable carotenoid cleavage dioxygenase 4, chloroplastic	55.435%	Swiss-Prot	strong database homology
`Q6YVJ0`	Oryza sativa subsp. japonica	9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic	51.341%	Swiss-Prot	strong database homology
`Q5MBR6`	Oryza sativa subsp. japonica	9-cis-epoxycarotenoid dioxygenase NCED2, chloroplastic	45.578%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card