TkA02G346900 | RubberDandelionOmics

Gene overview

TkA02G346900

Reference: TK1151 Chr: Chr02 Coordinates: 88123234-88124742 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1134 bp · TkA02G346900|TK1151|cDNA

ATGGTATACAATAACCTTCAAATCGATCTCAATAGTGATTTTGCAGACGATAATGATACCACTTTACGCCTGGAATGCTCTGGTTACGGTAATAAACAGGATAGTAAGAGTGCACCCAAAGATGGTAACGCATTGGTCGTCGGATTCAACCGAAACAAAAAACAAACGGACGAGGATTCAATTCTTGAACTTTCTCTTTCTCATTACTCTACTACTTCAAAGAGCGATCTGAATCCAAATTCTAATTATTACAGTGGATC...

CDS

Download CDS FASTA

1134 bp · TkA02G346900|TK1151|CDS

ATGGTATACAATAACCTTCAAATCGATCTCAATAGTGATTTTGCAGACGATAATGATACCACTTTACGCCTGGAATGCTCTGGTTACGGTAATAAACAGGATAGTAAGAGTGCACCCAAAGATGGTAACGCATTGGTCGTCGGATTCAACCGAAACAAAAAACAAACGGACGAGGATTCAATTCTTGAACTTTCTCTTTCTCATTACTCTACTACTTCAAAGAGCGATCTGAATCCAAATTCTAATTATTACAGTGGATC...

Protein

Download Protein FASTA

377 aa · TkA02G346900|TK1151|PROTEIN

MVYNNLQIDLNSDFADDNDTTLRLECSGYGNKQDSKSAPKDGNALVVGFNRNKKQTDEDSILELSLSHYSTTSKSDLNPNSNYYSGSFETSNKFGIHVFDEGSVSSKKSGGYMPSLLLAPRFEGLLQYEPSESSIVSDFSTESSIGHGGRRRCNHPTGCSNAARGNKSVHGGTKFCVNHGGGKRCVVPGCTSSARGRTHCCVKHGGGKRCRFENCTKGAQGSTDYCKGHGGGRRCGWEGEVKCEKFARGKDGLCVVHGTM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G346900`
TK1151 ID	TkA02G346900
OH-1004 ID	LXL04_001397
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	70.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G346900`
Location	Chr02:88123234-88124742 (-)
Description	Similar to WRKY19: Probable WRKY transcription factor 19
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001397` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006952 defense response Biological Process GO:0007165 signal transduction Biological Process GO:1902065 response to L-glutamate Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0009507 chloroplast Cellular Component GO:0009941 chloroplast envelope Cellular Component GO:0000976 transcription cis-regulatory region binding Molecular Function GO:0003700 DNA-binding transcription factor activity Molecular Function GO:0004674 protein serine/threonine kinase activity Molecular Function GO:0005524 ATP binding Molecular Function
KEGG gene cross-reference	ath:AT4G12020 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.961

Rank 1 · TkA02G346900 · TK1151

Cytoplasm0.107

Rank 2 · TkA02G346900 · TK1151

Cell membrane0.022

Rank 3 · TkA02G346900 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA02G346900 · TK1151

Plastid0.013

Rank 5 · TkA02G346900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24906Zf_WRKY19151-166 aa

PF24906Zf_WRKY19166-181 aa

PF24906Zf_WRKY19182-206 aa

PF24906Zf_WRKY19207-231 aa

PF24906Zf_WRKY19232-258 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G346900	`PF24906`	Zf_WRKY19	151	166	1.4e-14	54.3
TkA02G346900	`PF24906`	Zf_WRKY19	166	181	1.4e-14	54.3
TkA02G346900	`PF24906`	Zf_WRKY19	182	206	1.4e-14	54.3
TkA02G346900	`PF24906`	Zf_WRKY19	207	231	1.4e-14	54.3
TkA02G346900	`PF24906`	Zf_WRKY19	232	258	1.4e-14	54.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card