LXL04_001397 | RubberDandelionOmics

Gene overview

LXL04_001397

Reference: OH-1004 Chr: Chr01 Coordinates: 25609763-25611271 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1509 bp · LXL04_001397|LXL04_001397|OH1004|cDNA

ATGGTATACAATAACCTTCAAATCGATCTCAATAGTGATTTTGCAGACGATAATGATACCACTTTACGCCTGGAATGCTCTGGTTACGGTGGACGTGACATTAGCCTAGCGAACCCTAAACAACAGAATAAACAGGATAGTAAGAGTGCACCCAAAGATGGTAACGCATTGGTCGTCGGATTTGGGCCCACACCAACTACTTATTCTAATGATCATTCTTCTTCAGTAATCAACCGAAACAAAAAACAAACGGACGAGGA...

CDS

Download CDS FASTA

1509 bp · LXL04_001397|LXL04_001397|OH1004|CDS

ATGGTATACAATAACCTTCAAATCGATCTCAATAGTGATTTTGCAGACGATAATGATACCACTTTACGCCTGGAATGCTCTGGTTACGGTGGACGTGACATTAGCCTAGCGAACCCTAAACAACAGAATAAACAGGATAGTAAGAGTGCACCCAAAGATGGTAACGCATTGGTCGTCGGATTTGGGCCCACACCAACTACTTATTCTAATGATCATTCTTCTTCAGTAATCAACCGAAACAAAAAACAAACGGACGAGGA...

Protein

Download Protein FASTA

502 aa · LXL04_001397|LXL04_001397|OH1004|PROTEIN

MVYNNLQIDLNSDFADDNDTTLRLECSGYGGRDISLANPKQQNKQDSKSAPKDGNALVVGFGPTPTTYSNDHSSSVINRNKKQTDEDSILELSLSHYSTTSKSDLNPNSNYYSGSFETSNKFGIHVFDEGSVSSKKSGGYMPSLLLAPRFEGLLQYEPSESSIVSDFSTESSIGHGGRRRCNHPTGCSNAARGKWEFCIKHGGGKRCVVDGCDRSAELQLGLCISHGGGKRCCFLGCTNGAQGRTNYCKSHGGGKRCVFS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001397`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001397

Location Chr01:25609763-25611271 (-)

Description Similar to WRKY19: Probable WRKY transcription factor 19

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12020`	Transcription factor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001397 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:1902065 response to L-glutamate Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT4G12020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.969

Rank 1 · LXL04_001397 · OH-1004

Cytoplasm0.086

Rank 2 · LXL04_001397 · OH-1004

Cell membrane0.019

Rank 3 · LXL04_001397 · OH-1004

Plastid0.012

Rank 4 · LXL04_001397 · OH-1004

Endoplasmic reticulum0.011

Rank 5 · LXL04_001397 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24906.2Zf_WRKY19204-228 aa

PF24906.2Zf_WRKY19229-253 aa

PF24906.2Zf_WRKY19254-278 aa

PF24906.2Zf_WRKY19307-331 aa

PF24906.2Zf_WRKY19332-356 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001397	`PF24906.2`	Zf_WRKY19	204	228	1.5e-36	124.6
LXL04_001397	`PF24906.2`	Zf_WRKY19	229	253	1.5e-36	124.6
LXL04_001397	`PF24906.2`	Zf_WRKY19	254	278	1.5e-36	124.6
LXL04_001397	`PF24906.2`	Zf_WRKY19	307	331	1.5e-36	124.6
LXL04_001397	`PF24906.2`	Zf_WRKY19	332	356	1.5e-36	124.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ67`	Arabidopsis thaliana	Probable WRKY transcription factor 19	49.485%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card