TkA02G346870 | RubberDandelionOmics

Gene overview

TkA02G346870

Reference: TK1151 Chr: Chr02 Coordinates: 88109744-88117676 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1453 bp · TkA02G346870|TK1151|cDNA

AATGTGCACACTAGTTGCTTTGAGGTAACAGAGCCTGATGCTAATGATGAGGTTACCGACGAAAAAGAAGCTCATATGGGCAGTGTATTGGTTAGATATCGAAAGCCCTTACTTGAAAGGACACAACATCATTTGGGGTATCCATATAATTTGGACCTCGACTATGGTGCGTTATCTCAATTACAAAGTTTCTCCATCAACAACCTTGGGGACCCATTCATCGAGAGCAATTATGGTGTCCATTCCAGGCAGTTTGAAGT...

CDS

Download CDS FASTA

1191 bp · TkA02G346870|TK1151|CDS

ATGGGCAGTGTATTGGTTAGATATCGAAAGCCCTTACTTGAAAGGACACAACATCATTTGGGGTATCCATATAATTTGGACCTCGACTATGGTGCGTTATCTCAATTACAAAGTTTCTCCATCAACAACCTTGGGGACCCATTCATCGAGAGCAATTATGGTGTCCATTCCAGGCAGTTTGAAGTTGGTGTATTGGAATGGTTTGCTCGATTATGGGAACTAGAAAAGAATGAATATTGGGTTTACATTACAAATTGTGG...

Protein

Download Protein FASTA

396 aa · TkA02G346870|TK1151|PROTEIN

MGSVLVRYRKPLLERTQHHLGYPYNLDLDYGALSQLQSFSINNLGDPFIESNYGVHSRQFEVGVLEWFARLWELEKNEYWVYITNCGTEGNLHGILVGREVFPDGILYASCESHYSIFKAARMYRMDCEKVNTLVSGEIDCEDFKAKLSRHKNKPAIINVNIGTTVKGAVDGLDLVIKTLEETGFAHDRFYIHCDGALFGLMMPFVKLAPKVSFKKPIGSVSVSGHKFVGCPMPCGVQITRIEHINALSRNVEYLASRDA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G346870`
TK1151 ID	TkA02G346870
OH-1004 ID	LXL04_001396
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.900
Protein coverage (%)	TK1151 100.000 / OH-1004 75.862 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G346870

Location Chr02:88109744-88117676 (+)

Description Similar to SDC1: Serine decarboxylase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g43710`	Catalyzes the biosynthesis of ethanolamine from serine.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0541325`	Catalyzes the biosynthesis of ethanolamine from serine.	No verified direct reference in this release
`Os10g0105700`	Catalyzes the biosynthesis of ethanolamine from serine.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001396 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006522 alanine metabolic process Biological Process

GO:0006563 L-serine metabolic process Biological Process

GO:0006580 ethanolamine metabolic process Biological Process

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0019752 carboxylic acid metabolic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016831 carboxy-lyase activity Molecular Function

GO:0030170 pyridoxal phosphate binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0102705 serine decarboxylase activity Molecular Function

KEGG gene cross-reference

ath:AT1G43710

dosa:Os02g0541300

dosa:Os10g0105700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.673

Rank 1 · TkA02G346870 · TK1151

Nucleus0.360

Rank 2 · TkA02G346870 · TK1151

Mitochondrion0.078

Rank 3 · TkA02G346870 · TK1151

Cell membrane0.057

Rank 4 · TkA02G346870 · TK1151

Endoplasmic reticulum0.048

Rank 5 · TkA02G346870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00282Pyridoxal_deC106-313 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G346870	`PF00282`	Pyridoxal_deC	106	313	4e-20	72.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MA74`	Arabidopsis thaliana	sp\|Q9MA74\|SDC1_ARATH Serine decarboxylase	80.800%	Swiss-Prot	High
`Q6ESZ9`	Oryza sativa subsp. japonica	sp\|Q6ESZ9\|SDC1_ORYSJ Serine decarboxylase 1	83.300%	Swiss-Prot	High
`Q8RV06`	Oryza sativa subsp. japonica	sp\|Q8RV06\|SDC2_ORYSJ Serine decarboxylase 2	60.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card